KEGG Orthology (KO) [BR:shx00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
MS3_00001873 (POLR2H_1)
09124 Replication and repair
03420 Nucleotide excision repair
MS3_00001873 (POLR2H_1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:shx03021]
MS3_00001873 (POLR2H_1)
03400 DNA repair and recombination proteins [BR:shx03400]
MS3_00001873 (POLR2H_1)
Transcription machinery [BR:shx03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
MS3_00001873 (POLR2H_1)
RNA polymerase III system
RNA polymerase III
MS3_00001873 (POLR2H_1)
RNA polymerase I system
RNA polymerase I
MS3_00001873 (POLR2H_1)
DNA repair and recombination proteins [BR:shx03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
MS3_00001873 (POLR2H_1)
156 aa
MSALLEDIFDVKDVDKDGKKFDKVSRLFCESESFKMGLILDIHALIYGLSKGDKFRMVLT
KTLLNELGTDADDDDEDDAADETDEKLANSKMAEFDYVCYGKIYRIETQDSGVDSSRLSC
YVSFGGLLMQLTGDASNLQGFRVGKHLYLMIKKLAF
