KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_0282
Entry
SHJG_0282         CDS       T02063                                 
Name
(GenBank) glycosyltransferase
  KO
K20438  validoxylamine A glucosyltransferase [EC:2.4.1.338]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00525  Acarbose and validamycin biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
Module
shy_M00815  Validamycin A biosynthesis, sedoheptulopyranose-7P => validamycin A
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SHJG_0282
Enzymes [BR:shy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.338  validoxylamine A glucosyltransferase
     SHJG_0282
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C GNT-I Glyco_trans_2_3 Methyltransf_25 CHGN
Other DBs
NCBI-ProteinID: AEY85560
UniProt: H2K893
LinkDB
Position
378136..379404
AA seq 422 aa
MPGATSHVPLLSVVIPTYNRAALLDRTLGTLARQTTALEDFEVVVSDDGSTDTTRDVVRS
YEDRLRIKYVFQEDLGYRVASARNGGARLASAPLLAFLDTGVLAGPQYVQSVLAAHAGPA
PAKVVLGCCYGYDPRNPHPELHSLVEEFPPEEAVRRVGDAPWFQDMRLPEFTAVDFDLSR
MHMPWLWFWTLNVSLPAADFWRVGGFDEDFTGWGGEDIELGYRLHAHGIPMTVSRESWGI
EAPHERTHEANVSSLMLNCDRFVRKHPSLLPELFWAVTNRGIFGSVETERLRFEEWASQA
RGQQVLDEIAIGLDTLPPSQHTQRVAVFGSGTEGLPITPRQNVELFLCDYDEGVLARQES
RDDAAVSTWHLSGLRTPWPDQHFDLVIITSRMDGPRQAWGEAFTKEAHRIASSVVEPSLR
GD
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcccggtgcgacatcccatgtgccactgctctcggtcgtcatcccgacatacaaccga
gccgccctcctcgaccggacgttaggcacgctggcccgtcagacgacggcgctcgaggac
ttcgaggtcgtggtgtccgacgatggctcgacagacaccacccgcgacgtagtgcggtcc
tacgaggaccggctgcgcatcaagtacgtcttccaggaagaccttggataccgagtcgcc
agcgcgcgcaacggtggggcacgcctggcctccgcgccactcctggccttcctcgacact
ggtgtcctggcggggccgcagtacgtccagtcggtccttgccgcccatgccgggccggcg
cccgccaaggtggtcctcggctgctgctacggctacgatccgcggaatccccatcccgaa
ctccactcccttgtcgaggagttccccccggaggaggccgtgagaagggtcggggacgcc
ccctggttccaggacatgcggcttccggagttcactgcggtcgacttcgacctaagccgt
atgcacatgccctggctgtggttctggacgctcaacgtgtcgctgccggcagccgacttc
tggcgggtcggcgggttcgacgaggacttcaccggctggggcggggaggacatcgaactc
ggctaccggctgcacgcacacggcatccccatgacggtctcacgtgagagctgggggatc
gaagcgccgcacgagcgcactcatgaggcgaacgtctcctccctcatgctcaattgcgac
cggttcgtccgcaagcacccctccctgctccccgagctgttctgggcggtgaccaacagg
ggcatcttcggctccgtcgagactgagcggcttcgcttcgaggaatgggcaagccaggcc
cgcgggcaacaggtcctggacgagatcgccatcgggttggacaccctgcccccgtcgcag
cacacccagcgggtggcggtgttcggaagcggcacggaggggcttcccatcactccgcgg
cagaatgtcgaactcttcctgtgtgattacgatgagggggtgctcgcacggcaagagagc
cgcgacgatgccgccgtctcgacctggcatctgtccgggctgcgtaccccctggcccgac
cagcacttcgacctggtcatcatcacctcgcgcatggacgggccccggcaggcatggggc
gaggcgttcaccaaggaggcgcaccggatcgcgagctcagtcgtcgagccgtctcttcgc
ggtgactga

DBGET integrated database retrieval system