Sphingobium xenophagum: CJD35_14525 Help Entry CJD35_14525       CDS       T05146                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism shyd  Sphingobium xenophagum Brite KEGG Orthology (KO) [BR:shyd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:shyd03032]     CJD35_14525    03036 Chromosome and associated proteins [BR:shyd03036]     CJD35_14525    03400 DNA repair and recombination proteins [BR:shyd03400]     CJD35_14525 DNA replication proteins [BR:shyd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CJD35_14525 Chromosome and associated proteins [BR:shyd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CJD35_14525 DNA repair and recombination proteins [BR:shyd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CJD35_14525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 GTP_EFTU_D2 DUF2267 VWA_3 Glyco_transf_29 Motif Other DBs NCBI-ProteinID:  ASY45511 UniProt:  A0A249MVW7 LinkDB All DBs Position I:complement(2978499..2978771) Genome browser AA seq 90 aa AA seqDB search MNKQDLISAVADSSGLSKSDASKAVEGVFDAITGALKKGDEVRLVGFGTFSVSQRKASTG RNPRTGETMTIKASAQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggatcttatcagcgctgtcgcggacagcagcggtctcagcaaaagcgac gccagcaaggccgtcgaaggtgtattcgacgccatcaccggtgcgttgaagaagggcgac gaagtgcgcctggttggttttggcacattttccgtttcgcagcgcaaggcgtcgaccggt cgcaacccgcgcaccggcgagacgatgacgatcaaggcgtcggcccagcccaagttcaag gctggcaagggtctcaaggattcggtcaactga

DBGET integrated database retrieval system