Shinella sp. HZN7: shn_00915 Help Entry shn_00915         CDS       T04278                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism shz  Shinella sp. HZN7 Pathway shz01100   Metabolic pathways shz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     shn_00915    00074 Mycolic acid biosynthesis     shn_00915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     shn_00915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ANH02739 LinkDB All DBs Position complement(188781..189029) Genome browser AA seq 82 aa AA seqDB search MEDVRTEIAERVKNIIVGQLVVEKSKVVDDASIVDDLGADSLEVVQIVMLIEDEFGITIP DAPAEEFLTVQDAIDFVVASQP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaagacgtaagaaccgagatagctgaacgtgtgaagaatattatcgtcgggcagttg gtcgtcgagaaatcgaaggtcgtcgacgatgcctcgatcgtcgacgacctgggtgccgat tccctggaggtggtccagatcgtgatgctcatcgaggacgagtttggcattaccattccc gatgcgccggccgaggaattcctgacggttcaggacgccatcgacttcgtggtcgcatcg cagccgtga

DBGET integrated database retrieval system