Shinella sp. HZN7: shn_23285 Help Entry shn_23285         CDS       T04278                                  Name (GenBank) hypothetical protein   KO K18997   chaperone modulatory protein CbpM Organism shz  Shinella sp. HZN7 Brite KEGG Orthology (KO) [BR:shz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:shz03036]     shn_23285 Chromosome and associated proteins [BR:shz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     shn_23285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MerR_2 MerR_1 Motif Other DBs NCBI-ProteinID:  ANH07428 UniProt:  A0A1A9GA42 LinkDB All DBs Position pShin-01:193538..193813 Genome browser AA seq 91 aa AA seqDB search MTREEFLKSSGLKMQVLELWIEQEWLVPERTPSGLRFREIDVARARLIGELQSGIGANEA GIDVILHLMDQLHGMRRALAELRREMGKADV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccagagaggaattcctgaaatcctccggcctcaagatgcaggtgctggagttgtgg atcgagcaggaatggctggtgccggagaggacgccgtccggcctgcgcttccgggagatc gacgtcgcccgggcgcggctgatcggcgagctgcagtccggcatcggcgcgaacgaggcg ggcatcgacgtgatcctgcatctcatggaccagttgcacggcatgcgccgggcgctcgcg gagctgcggcgggaaatgggcaaggcggacgtctga

DBGET integrated database retrieval system