Saccharolobus islandicus M.14.25: M1425_1672 Help Entry M1425_1672        CDS       T00890                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sia  Saccharolobus islandicus M.14.25 Pathway sia03010   Ribosome Brite KEGG Orthology (KO) [BR:sia00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M1425_1672   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M1425_1672  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sia03011]     M1425_1672    04121 Ubiquitin system [BR:sia04121]     M1425_1672   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sia04147]     M1425_1672 Ribosome [BR:sia03011]  Ribosomal proteins   Eukaryotes    Small subunit     M1425_1672   Archaea     M1425_1672 Ubiquitin system [BR:sia04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M1425_1672 Exosome [BR:sia04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    M1425_1672   Exosomal proteins of colorectal cancer cells    M1425_1672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB YPEH2ZP Zn_ribbon_RPB9 IBR Zn_ribbon_Nudix Zn_ribbon_PriA UPF0179 Zn_Ribbon_1 FlhC YhfH DUF7838 Zn_ribbon_3 DUF5795 DUF1451 Zn_ribbon_13 DUF6758 Motif Other DBs NCBI-ProteinID:  ACP38421 UniProt:  C3MWX1 LinkDB All DBs Position 1549807..1549998 Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYIIEGNKVKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGTS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaagaacttattacataattgaagggaat aaggttaagctaaaaaataagaaatgtcctagatgcggaagtataatggctcaccactta aaaccaaatgagagatggtcttgtggaaaatgtggttacactgagtttataggcacttca aagaaaagataa

DBGET integrated database retrieval system