Saccharolobus islandicus M.16.4: M164_1719 Help Entry M164_1719         CDS       T00906                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sid  Saccharolobus islandicus M.16.4 Pathway sid03010   Ribosome Brite KEGG Orthology (KO) [BR:sid00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     M164_1719   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     M164_1719  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sid03011]     M164_1719    04121 Ubiquitin system [BR:sid04121]     M164_1719   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sid04147]     M164_1719 Ribosome [BR:sid03011]  Ribosomal proteins   Eukaryotes    Small subunit     M164_1719   Archaea     M164_1719 Ubiquitin system [BR:sid04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    M164_1719 Exosome [BR:sid04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    M164_1719   Exosomal proteins of colorectal cancer cells    M164_1719 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB YPEH2ZP Zn_ribbon_RPB9 UPF0179 Zn_ribbon_Nudix Zn_Ribbon_1 Lar_restr_allev Zn_ribbon_PriA DUF5817 FlhC YhfH DUF5795 Zn_ribbon_13 DUF1451 UPF0547 Zn_ribbon_3 DZR DUF6758 Motif Other DBs NCBI-ProteinID:  ACR42323 UniProt:  C4KIA9 LinkDB All DBs Position 1575935..1576126 Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKVKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGTS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaagaacttattacgtaattgaagggaat aaggttaagctaaaaaataagaaatgtcctagatgcggaagtataatggctcaccactta aaaccaaatgagagatggtcttgtggaaaatgtggttacactgagtttataggcacttca aagaaaagataa

DBGET integrated database retrieval system