Streptococcus iniae SF1: K710_2062 Help Entry K710_2062         CDS       T02686                                  Name (GenBank) chaperone GroES   KO K04078   chaperonin GroES Organism sik  Streptococcus iniae SF1 Brite KEGG Orthology (KO) [BR:sik00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sik03110]     K710_2062    03029 Mitochondrial biogenesis [BR:sik03029]     K710_2062 Chaperones and folding catalysts [BR:sik03110]  Heat shock proteins   HSP10    K710_2062 Mitochondrial biogenesis [BR:sik03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     K710_2062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF6950 DUF4537 Motif Other DBs NCBI-ProteinID:  AGM99804 LinkDB All DBs Position complement(2015693..2015983) Genome browser AA seq 96 aa AA seqDB search MLKPLGDRVLVKVDQDKEQTVGGFVLASGHHEATRQATVLAVSETGMRTITGEVVPSSVQ VGDRVLIENGHGLALTVDDENVTLVRESDILAIISK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgttaaaacccttaggagaccgtgttctcgttaaagttgatcaagataaagaacaaacg gttggtggttttgtccttgccagcggacaccatgaagcaacaagacaagcaactgtttta gccgtcagtgaaacaggtatgcgtactattacaggagaagttgtgccttcatcagttcaa gtaggagaccgtgttttgattgaaaatggtcatggccttgcccttactgttgatgatgaa aatgttacattggttcgtgaatctgatattctagcaattatctcaaaataa

DBGET integrated database retrieval system