Ruegeria pomeroyi: SPO1931 Help Entry SPO1931           CDS       T00215                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism sil  Ruegeria pomeroyi Pathway sil01100   Metabolic pathways sil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPO1931    00074 Mycolic acid biosynthesis     SPO1931   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPO1931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AAV95207 UniProt:  Q5LS39 LinkDB All DBs Position 2059085..2059342 Genome browser AA seq 85 aa AA seqDB search MSISDRVIAIIAEQAVLEPSDVSPESTLEDLGIDSLGLVESIFAIEEEFDISIPFNANEP SQSDFDISNVAAIIAGIEKLVSEKV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagcgaccgtgttatcgccatcatcgccgagcaggccgtgctggagccatct gacgtcagccccgaaagcacgcttgaggatctgggcatcgacagcctgggccttgtggaa agcatctttgccatcgaagaggaattcgacatctcgatccccttcaatgccaacgaaccc agccagagcgatttcgacatctcgaacgtggccgcgattatcgcgggcatcgagaaactg gtgtcggaaaaggtctga

DBGET integrated database retrieval system