Ruegeria pomeroyi: SPO2274 Help Entry SPO2274           CDS       T00215                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sil  Ruegeria pomeroyi Pathway sil01100   Metabolic pathways sil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPO2274 (acpP)    00074 Mycolic acid biosynthesis     SPO2274 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPO2274 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AAV95538 UniProt:  Q5LR57 LinkDB All DBs Position complement(2413530..2413763) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgcgttaagaagatcgttgtggagcacctgggtgtcgaagaa gacaaagtgaccgagaatgcctcgttcatcgacgacctgggcgccgacagcctcgacacc gtcgagctggtcatggctttcgaagaagagttcggcatcgagatcccggacgacgcggcc gaaaccatccagaccttcggcgacgccgtcaagttcatcagcgaagcctcctga

DBGET integrated database retrieval system