Sphingopyxis indica: KNJ79_11720 Help Entry KNJ79_11720       CDS       T09492                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sina  Sphingopyxis indica Brite KEGG Orthology (KO) [BR:sina00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sina03032]     KNJ79_11720    03036 Chromosome and associated proteins [BR:sina03036]     KNJ79_11720    03400 DNA repair and recombination proteins [BR:sina03400]     KNJ79_11720 DNA replication proteins [BR:sina03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KNJ79_11720 Chromosome and associated proteins [BR:sina03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KNJ79_11720 DNA repair and recombination proteins [BR:sina03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KNJ79_11720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Peptidase_M35 MSP1_barrel KORA Motif Other DBs NCBI-ProteinID:  WOF41908 LinkDB All DBs Position complement(2460823..2461095) Genome browser AA seq 90 aa AA seqDB search MNKQDLIATVADSSGLTKGDASKAVEAVFDAITASLKKGGEVRLVGFGTFSVSKRKASTG RNPRTGETMTIAASNQPKFKAGKALKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagacctgatcgccaccgtcgctgactcgagcggcctcaccaagggcgat gcgagcaaggcggttgaagccgttttcgacgcgatcaccgcgtcgctgaagaagggcggc gaagtccgtctcgtcggcttcgggacgttctcggtcagcaagcgcaaggcgtcgacgggt cgcaacccgcgcaccggcgaaacgatgaccatcgcggcgtcgaaccagccgaagttcaag gccggcaaggccctcaaggacgcctgcaactaa

DBGET integrated database retrieval system