KEGG   Sphingopyxis indica: KNJ79_18535
Entry
KNJ79_18535       CDS       T09492                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
sina  Sphingopyxis indica
Pathway
sina02024  Quorum sensing
sina03060  Protein export
sina03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sina00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    KNJ79_18535 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KNJ79_18535 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KNJ79_18535 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sina03029]
    KNJ79_18535 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sina02044]
    KNJ79_18535 (yidC)
Mitochondrial biogenesis [BR:sina03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    KNJ79_18535 (yidC)
Secretion system [BR:sina02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   KNJ79_18535 (yidC)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP Abhydrolase_9_N DUF3899
Other DBs
NCBI-ProteinID: WOF43100
LinkDB
Position
3927251..3928999
AA seq 582 aa
MDDKRNLIAAILLSVAILLGWNFVADKFFPTPDKPDVTTTVAGSDGAAPKAQGEPNGLPE
AGTAVPAAKPATQAIRPVEAVLGGGQRIGIETPALSGSINLVGARIDDITLTKYRQTVEK
NSPPVRLFAPAGTKAAYFASIGWSAQGIATPGADTVWTASGDKLTPETPVTLSWSNGSGQ
SFRIEYSIDKNYLITAKQTIANSGSAPVTASSYALIDRLGKPTDPHEKDSYTIHVGPTGY
LDGKSVFDVDYDDLDESGAVKYASAGWLGFTDKYWLAAIIPAKGERVTASISTPSADNYQ
TLFARPFTQVAPGRQVTTTSRIFAGAKEVSILSAYQNKQDITRLSNAIDWGWFEFFEVPI
FKLLDWLFRMVGNFGVAIMLLTLIIRAAMFPVAQRQFRSMAQMRLVQPKMKALQERHKDD
KPKMQQELMKLYKDEKINPLAGCLPIVIQIPIFYALYKVLMLTIEMRHQPFILWIKDLSA
PDPLHILNLFGLLPFTPPSFLGIGLLALILGVTMWLQFRLNPQATDPVQQQVFKIMPWLF
MFIMAPFAAGLLLYWITNNCLSIAQQQWMYRKYPQLKAVAAK
NT seq 1749 nt   +upstreamnt  +downstreamnt
gtggacgacaagcggaacctgatcgcggcgattttattgtcggtggccatcctgctcgga
tggaatttcgtcgccgacaaattctttccgacgcccgacaagcccgatgtgaccacgacg
gtcgccggaagcgacggtgcggcgccgaaagcgcagggcgagcccaacggcctgcccgag
gccgggacggcggtgcccgcggcaaagcccgcgacgcaggcgatccgccctgtcgaggcg
gtgctcggcggcggacagcgcatcggaatcgaaaccccggcgctgtcgggttcgatcaac
ctcgtcggcgcgcgcatcgacgacatcacgctgaccaaatatcgccagacggtcgagaag
aattcgccccccgtccgcctgttcgcccccgcgggcaccaaggccgcatatttcgcgagc
atcggctggtcggcgcaggggatcgcaacccccggcgccgatacggtctggacggcgagc
ggcgacaagctgacccccgaaacgccggtgacgctgagctggtcgaacggcagcggccag
agttttcgtatcgaatatagcatcgacaaaaattacctgatcaccgcgaagcagacgatc
gccaacagcggcagcgcgccggtgaccgcgagcagctatgcgctgatcgaccgcctcggc
aaaccgaccgatccgcacgagaaggacagctatacgatccacgtcggtccgaccggctat
ctcgacggcaaatcggtattcgacgtcgactacgacgatctcgacgagagcggcgcggtc
aaatatgcgagtgcgggctggctgggcttcaccgacaaatattggctagccgcgatcatc
cccgccaagggcgagcgcgtcaccgcgtcgatcagcacgccgtcggcggacaattaccag
acgctgttcgcgcggcccttcacacaggtcgcgccgggccggcaggtcacgacgacgagc
cgcatctttgccggcgcgaaggaagtgagcatcctgtcggcctatcagaacaagcaggac
atcacccgcctgtcgaacgcgatcgactggggctggttcgaatttttcgaggtgccgatc
ttcaagctgctcgactggctgttccgcatggtcggcaatttcggcgtcgcgatcatgctg
ctgaccctgatcattcgcgccgcgatgttcccggtcgcgcagcggcagttccggtcgatg
gcgcagatgcggctcgtccagccgaagatgaaggcgctgcaggagcggcacaaggacgac
aagccgaagatgcagcaggagctgatgaagctctataaggacgagaagatcaatccgctc
gccggctgcctgccgatcgtcatccagatcccgatcttctatgcgctctacaaggtgctg
atgctgacgatcgagatgcgccaccagcccttcatcctgtggatcaaggatctgtcggcg
cccgatccgctgcacatattgaacctgttcggcctcttgcccttcacgccgccgtccttc
ctcggcatcggcctgctcgcgctgatcctgggcgtcaccatgtggctgcagttccgcctg
aacccgcaggcgaccgacccggtgcagcagcaggtgttcaagatcatgccgtggctgttc
atgttcatcatggcgcccttcgcggcgggcctcctgctctactggatcaccaacaactgc
ctgtcgatcgcgcagcagcagtggatgtaccgcaaatatccgcagctgaaggcggtggcg
gcgaaatag

DBGET integrated database retrieval system