Sphingopyxis indica: KNJ79_18535
Help
Entry
KNJ79_18535 CDS
T09492
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
sina
Sphingopyxis indica
Pathway
sina02024
Quorum sensing
sina03060
Protein export
sina03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
sina00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
KNJ79_18535 (yidC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
KNJ79_18535 (yidC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
KNJ79_18535 (yidC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
sina03029
]
KNJ79_18535 (yidC)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
sina02044
]
KNJ79_18535 (yidC)
Mitochondrial biogenesis [BR:
sina03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
KNJ79_18535 (yidC)
Secretion system [BR:
sina02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
KNJ79_18535 (yidC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
Abhydrolase_9_N
DUF3899
Motif
Other DBs
NCBI-ProteinID:
WOF43100
LinkDB
All DBs
Position
3927251..3928999
Genome browser
AA seq
582 aa
AA seq
DB search
MDDKRNLIAAILLSVAILLGWNFVADKFFPTPDKPDVTTTVAGSDGAAPKAQGEPNGLPE
AGTAVPAAKPATQAIRPVEAVLGGGQRIGIETPALSGSINLVGARIDDITLTKYRQTVEK
NSPPVRLFAPAGTKAAYFASIGWSAQGIATPGADTVWTASGDKLTPETPVTLSWSNGSGQ
SFRIEYSIDKNYLITAKQTIANSGSAPVTASSYALIDRLGKPTDPHEKDSYTIHVGPTGY
LDGKSVFDVDYDDLDESGAVKYASAGWLGFTDKYWLAAIIPAKGERVTASISTPSADNYQ
TLFARPFTQVAPGRQVTTTSRIFAGAKEVSILSAYQNKQDITRLSNAIDWGWFEFFEVPI
FKLLDWLFRMVGNFGVAIMLLTLIIRAAMFPVAQRQFRSMAQMRLVQPKMKALQERHKDD
KPKMQQELMKLYKDEKINPLAGCLPIVIQIPIFYALYKVLMLTIEMRHQPFILWIKDLSA
PDPLHILNLFGLLPFTPPSFLGIGLLALILGVTMWLQFRLNPQATDPVQQQVFKIMPWLF
MFIMAPFAAGLLLYWITNNCLSIAQQQWMYRKYPQLKAVAAK
NT seq
1749 nt
NT seq
+upstream
nt +downstream
nt
gtggacgacaagcggaacctgatcgcggcgattttattgtcggtggccatcctgctcgga
tggaatttcgtcgccgacaaattctttccgacgcccgacaagcccgatgtgaccacgacg
gtcgccggaagcgacggtgcggcgccgaaagcgcagggcgagcccaacggcctgcccgag
gccgggacggcggtgcccgcggcaaagcccgcgacgcaggcgatccgccctgtcgaggcg
gtgctcggcggcggacagcgcatcggaatcgaaaccccggcgctgtcgggttcgatcaac
ctcgtcggcgcgcgcatcgacgacatcacgctgaccaaatatcgccagacggtcgagaag
aattcgccccccgtccgcctgttcgcccccgcgggcaccaaggccgcatatttcgcgagc
atcggctggtcggcgcaggggatcgcaacccccggcgccgatacggtctggacggcgagc
ggcgacaagctgacccccgaaacgccggtgacgctgagctggtcgaacggcagcggccag
agttttcgtatcgaatatagcatcgacaaaaattacctgatcaccgcgaagcagacgatc
gccaacagcggcagcgcgccggtgaccgcgagcagctatgcgctgatcgaccgcctcggc
aaaccgaccgatccgcacgagaaggacagctatacgatccacgtcggtccgaccggctat
ctcgacggcaaatcggtattcgacgtcgactacgacgatctcgacgagagcggcgcggtc
aaatatgcgagtgcgggctggctgggcttcaccgacaaatattggctagccgcgatcatc
cccgccaagggcgagcgcgtcaccgcgtcgatcagcacgccgtcggcggacaattaccag
acgctgttcgcgcggcccttcacacaggtcgcgccgggccggcaggtcacgacgacgagc
cgcatctttgccggcgcgaaggaagtgagcatcctgtcggcctatcagaacaagcaggac
atcacccgcctgtcgaacgcgatcgactggggctggttcgaatttttcgaggtgccgatc
ttcaagctgctcgactggctgttccgcatggtcggcaatttcggcgtcgcgatcatgctg
ctgaccctgatcattcgcgccgcgatgttcccggtcgcgcagcggcagttccggtcgatg
gcgcagatgcggctcgtccagccgaagatgaaggcgctgcaggagcggcacaaggacgac
aagccgaagatgcagcaggagctgatgaagctctataaggacgagaagatcaatccgctc
gccggctgcctgccgatcgtcatccagatcccgatcttctatgcgctctacaaggtgctg
atgctgacgatcgagatgcgccaccagcccttcatcctgtggatcaaggatctgtcggcg
cccgatccgctgcacatattgaacctgttcggcctcttgcccttcacgccgccgtccttc
ctcggcatcggcctgctcgcgctgatcctgggcgtcaccatgtggctgcagttccgcctg
aacccgcaggcgaccgacccggtgcagcagcaggtgttcaagatcatgccgtggctgttc
atgttcatcatggcgcccttcgcggcgggcctcctgctctactggatcaccaacaactgc
ctgtcgatcgcgcagcagcagtggatgtaccgcaaatatccgcagctgaaggcggtggcg
gcgaaatag
DBGET
integrated database retrieval system