KEGG   Sphingobium indicum B90A: SIDU_00415
Entry
SIDU_00415        CDS       T04604                                 
Name
(GenBank) two-component system response regulator
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
sinb  Sphingobium indicum B90A
Pathway
sinb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SIDU_00415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sinb02022]
    SIDU_00415
Two-component system [BR:sinb02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   SIDU_00415
SSDB
Motif
Pfam: Response_reg Trans_reg_C PDE8A_N DUF7669
Other DBs
NCBI-ProteinID: APL93117
UniProt: A0A1L5BK12
LinkDB
Position
complement(81343..82044)
AA seq 233 aa
MARARMLLVEDDAALAELLIWHFKREDFEVVHTVDGEEALLLAQENVPDIVLLDWMVESL
SGIEVCRRLRRMNGTANVPIIMLTARGEEEDRVRGLETGADDYVTKPFSPRELVARVGAV
LRRVRPALAGETLTFADVEMDTVGHKVRRGGQVIPLGPTEFRLLKHFLEHPGWVFSRERL
LDSVWGQDSDIELRTVDVHIRRLRKAINADGRHRDIIRTVRSAGYALDTDGAA
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgcgggccaggatgctgctggtggaggatgacgcggcgttggccgaactgctcatc
tggcacttcaagcgcgaggatttcgaggtcgtccatacggtggacggcgaggaagcgctg
cttctggcgcaggagaatgtgcccgacatcgtgctgctcgactggatggtggaaagcctg
tcgggcatagaggtctgccgccgcctgcgccgcatgaacggcacggccaacgtgccgatc
atcatgctgaccgcgaggggcgaggaggaggatcgcgtgcgcgggctggaaacgggcgcg
gacgattatgtgaccaagcccttctcgccccgcgaactggtggcgcgcgtcggcgcggtg
ctgcggcgcgtgcgccccgcgctggcgggcgagacgctgaccttcgcggatgtggagatg
gacacggtggggcacaaggtccgtcgcggcggccaggtgatcccgctcggccccacggaa
ttccgcctgctcaagcatttcctggagcatcccggctgggtcttctcccgcgagcggctg
ctggacagcgtatgggggcaggacagcgacatcgaactgcgcacggtggacgtgcatatc
cgccgcctgcgcaaggcgatcaacgcggacggccgccatcgcgacatcatccgcacggtg
cgctcggccggctatgcgctggataccgacggagcggcgtga

DBGET integrated database retrieval system