Sphingobium indicum B90A: SIDU_02450 Help Entry SIDU_02450        CDS       T04604                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism sinb  Sphingobium indicum B90A Brite KEGG Orthology (KO) [BR:sinb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sinb03110]     SIDU_02450    03029 Mitochondrial biogenesis [BR:sinb03029]     SIDU_02450 Chaperones and folding catalysts [BR:sinb03110]  Heat shock proteins   HSP10    SIDU_02450 Mitochondrial biogenesis [BR:sinb03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     SIDU_02450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  APL93473 UniProt:  A0A1L5BKT6 LinkDB All DBs Position 492945..493229 Genome browser AA seq 94 aa AA seqDB search MTFRPLHDRVLDRRIVAAAQAAGGIVMPDTVKEKPQEGEIVSAGPGAKAENGMLTPLDLK TGDRVLFSKFGSEVRLDGEDLLIMKESDVLGIIG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgacatttcgacctcttcacgatcgcgtgctcgatcgccgcatcgtcgctgccgcgcaa gccgcgggcggcatcgtcatgcccgataccgtaaaggagaagccgcaggagggcgagatc gtctccgcgggcccgggcgccaaagccgagaatggcatgcttacgccgctcgacctcaag actggtgatcgcgtcctgttcagcaagtttggttccgaggtgagactggacggtgaggac cttctcatcatgaaggaaagcgacgtcctcggcatcattggctga

DBGET integrated database retrieval system