KEGG   Sphingobium indicum: SIDU_04785
Entry
SIDU_04785        CDS       T04604                                 
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
sinb  Sphingobium indicum
Pathway
sinb00361  Chlorocyclohexane and chlorobenzene degradation
sinb01100  Metabolic pathways
sinb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    SIDU_04785
Enzymes [BR:sinb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     SIDU_04785
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg DUF3209 DUF2520
Other DBs
NCBI-ProteinID: APL93878
UniProt: A0A1L5BM33
LinkDB
Position
complement(1006917..1007672)
AA seq 251 aa
MPMESEQLEAVVMDIVAGIRDAIIKHHVTVDQYRFAVDYLGRLADARELPLLLDVFLNVA
AVDAENEVTKGSPQAIQGPYYREDAPAVTDRLKTLDHDNERPLVVRGQVRDIDGSLLPGA
EVDIWHSTPTGKYSGFHDNIPVDYYRGKLTSDSEGAYRVATTAPVPYQIPNQGYTGALLE
AMGRHSWRPAHVHFKVRKPGFKTVTTQVYFEGGQWVDSDCCSGVRDDLVRRTTQEDGVDT
LTVDFVLDRAA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgccgatggagtccgaacagcttgaggccgtagtgatggatatcgtcgcgggaatacgc
gacgccatcataaagcatcatgtgacggtcgatcagtaccgcttcgccgtcgactatctc
ggccggctggcggacgccagggaactgccgctcctcctcgacgtcttcctgaacgtggcc
gcggtcgacgcggaaaacgaggtgacgaagggttctccgcaggcgatccagggcccctat
tacagggaggatgcgcccgccgtcaccgaccggctcaagaccctcgatcatgacaatgag
cgtccgctcgtcgtccggggccaggtgcgcgacatcgatgggtccctcctgcccggagcg
gaggtcgacatctggcactcgaccccgaccggaaaatatagcgggttccacgacaatatc
cccgtcgattattatcggggcaagctgacgtcggacagcgaaggcgcctatcgcgtcgcg
accacggcgccggttccctaccagatccccaaccagggctataccggcgcgctgctggag
gcgatgggacgccatagctggcgccccgcgcacgtccacttcaaggtgcgcaagcccggg
ttcaagacggtcacgacccaggtctatttcgagggcggccaatgggtcgacagtgattgc
tgcagcggcgtgcgcgacgatctggtccgccggacgacgcaggaggacggcgtcgatacg
ctgacggtcgacttcgttctcgaccgcgcggcctga

DBGET integrated database retrieval system