Sphingobium indicum B90A: SIDU_08275 Help Entry SIDU_08275        CDS       T04604                                  Name (GenBank) toluene monooxygenase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism sinb  Sphingobium indicum B90A Pathway sinb00361   Chlorocyclohexane and chlorobenzene degradation sinb00362   Benzoate degradation sinb00623   Toluene degradation sinb01100   Metabolic pathways sinb01120   Microbial metabolism in diverse environments sinb01220   Degradation of aromatic compounds Module sinb_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:sinb00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     SIDU_08275    00361 Chlorocyclohexane and chlorobenzene degradation     SIDU_08275    00623 Toluene degradation     SIDU_08275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  APL94495 UniProt:  A0A1L5BNL8 LinkDB All DBs Position complement(1729571..1729822) Genome browser AA seq 83 aa AA seqDB search MAEQPQSDILDAKFVRVRNRRENGLVEFDFAIGAPEIFVELLMPTAAFEEFCAVNRVIDV TGQPLEQDDFDVRLARVIAGEAR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcggaacagccgcaatccgacatattggacgcgaagttcgtgcgcgtccgcaaccgc cgcgaaaacgggctggtcgaattcgacttcgccatcggcgcgccggaaatcttcgtggaa ctgctgatgccgaccgcggcgttcgaggaattctgcgccgtcaaccgcgtgatcgacgta accggccagccgctggagcaggacgatttcgacgtccggctggcgcgggtgatcgccggc gaagcccgatag

DBGET integrated database retrieval system