Stenotrophomonas indicatrix: DAIF1_34480 Help Entry DAIF1_34480       CDS       T07128                                  Name (GenBank) ACT domain protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism sinc  Stenotrophomonas indicatrix Pathway sinc00290   Valine, leucine and isoleucine biosynthesis sinc00650   Butanoate metabolism sinc00660   C5-Branched dibasic acid metabolism sinc00770   Pantothenate and CoA biosynthesis sinc01100   Metabolic pathways sinc01110   Biosynthesis of secondary metabolites sinc01210   2-Oxocarboxylic acid metabolism sinc01230   Biosynthesis of amino acids Module sinc_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine sinc_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:sinc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     DAIF1_34480    00660 C5-Branched dibasic acid metabolism     DAIF1_34480   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     DAIF1_34480   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     DAIF1_34480 Enzymes [BR:sinc01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      DAIF1_34480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 GKAP Motif Other DBs NCBI-ProteinID:  QBR45861 LinkDB All DBs Position 3807158..3807409 Genome browser AA seq 83 aa AA seqDB search MQYRLDLVLQPAEGALLRVIGMAERRGFAPRAITGAPVAADDGRWHLQLVVDSQRPPETL CRQMEKIYDCVSVQMTALEGASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgacctggtgctgcaaccggccgagggcgcgctgctgcgcgtgatc ggcatggccgaacgccgcggtttcgcgccgcgcgcgatcaccggtgcgccggtggccgcc gatgatggtcgttggcacctgcaactggtggtggacagccagcgcccgccggaaacgctg tgccggcagatggaaaagatctacgactgcgtttcggtgcagatgaccgcactggaagga gcatccgcatga

DBGET integrated database retrieval system