Stenotrophomonas indicatrix: DAIF1_40630 Help Entry DAIF1_40630       CDS       T07128                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sinc  Stenotrophomonas indicatrix Pathway sinc01100   Metabolic pathways sinc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sinc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DAIF1_40630    00074 Mycolic acid biosynthesis     DAIF1_40630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DAIF1_40630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBR46468 LinkDB All DBs Position complement(4478842..4479099) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctcgctttcactggaggac atcaccccggaggacatcgatccgaccgcgcctctgttcgtggaaggcctcggcctggac tcgatcgatgcactggaactgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgactcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system