Sesamum indicum (sesame): 105158250
Help
Entry
105158250 CDS
T04135
Name
(RefSeq) tubby-like protein 8
KO
K19600
tubby and related proteins
Organism
sind
Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:
sind00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
sind03037
]
105158250
04990 Domain-containing proteins not elsewhere classified [BR:
sind04990
]
105158250
Cilium and associated proteins [BR:
sind03037
]
Primary cilia and associated proteins
Other primary cilia associated proteins
105158250
Domain-containing proteins not elsewhere classified [BR:
sind04990
]
Other domain-containing proteins
Tubby family proteins
105158250
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tub
DUF5417
Motif
Other DBs
NCBI-GeneID:
105158250
NCBI-ProteinID:
XP_011073226
UniProt:
A0A6I9SRZ9
LinkDB
All DBs
Position
LG3:complement(13265310..13268542)
Genome browser
AA seq
413 aa
AA seq
DB search
MAGCKKTTISRQSSYTSMYRNPLIEQKHHRSSSEGGGNSVSLGAHMRRNLEVISDDKENA
EPNVKPGKQYCDGKENEVPGDGNTPILKEFSGRTTQMKENLLKPSSLQLCIKKYEPDSNI
GLKIWDSVDSEKSNSVNVWDYSDSEAAPASSWSALPNRALLYRPLPVDVGRCTCIIVKET
SPDGFDGGTLYTLYTNEGKGRQNRKLAVALHRRRRGRSEFTIAQNAKGIMARSEDSLIGI
VTANLVGSKYHIWDQGHCLNSLTKHPKLLAAVKFIPTVSTWTGNYRSMKAWIPKHQSMQL
KNTNQIQHINGLPAEWEGNKDKVHQLFSKVPSYNKFSKRYELDFRDRGRAGLKIQSSVKN
FQLTLERNGKQTILQLGRLGKSKYVMDYRYPLTGYQAFCMCLASVDSKLCCTV
NT seq
1242 nt
NT seq
+upstream
nt +downstream
nt
atggctggctgcaagaaaaccacaatttctcgtcagtcttcgtacacttccatgtaccgt
aatccccttattgagcagaaacaccaccgcagctctagcgagggaggcggaaacagcgtt
tctcttggagcccacatgcgccggaatttagaagttatcagtgatgataaagagaatgct
gagccaaatgtgaagcccggaaaacagtactgtgatggcaaagaaaatgaagtccccggt
gatgggaatacgccaatcttgaaagagttttcaggtaggactactcagatgaaggagaat
ttgttgaagccatcttcgcttcagttgtgcataaagaaatacgagcctgattcgaatatt
ggattgaagatatgggattccgttgattcggagaaatcgaattcagtcaatgtgtgggac
tattctgattcagaagctgcaccggcttcgtcctggtcggctttgcctaacagggccttg
ttatataggcctttgcctgtggatgttgggaggtgcacatgtataatagtgaaggaaaca
tcgcccgacggattcgatggaggaactttgtacacattatatacaaatgagggtaagggg
cggcaaaatcgcaaacttgctgtggctcttcacagaaggcgtagaggaagatcagagttc
acaattgctcaaaatgcaaaagggataatggcacgttccgaggacagtttaatcgggata
gtgactgctaatcttgtgggctcgaagtaccatatatgggatcaggggcattgtctgaat
tccttgactaaacaccccaaattattggctgctgtgaaatttatccctactgtatcaacc
tggactgggaattatcgaagcatgaaggcatggattccaaagcaccaatctatgcagcta
aagaatacaaatcagatacaacatattaatggattgccggcggaatgggaggggaacaag
gacaaagttcatcagctattttcaaaagtcccttcttacaacaagttctcgaaacggtac
gagttagatttcagagacagaggacgggcaggtcttaaaatccagagctcagtcaagaac
ttccaattaactttggagaggaacgggaagcaaacgattcttcagctcggacggctgggg
aagtccaaatatgtcatggattacagatatccattgaccggttatcaagccttctgcatg
tgtttggcttctgtcgattcaaaactctgctgcacagtataa
DBGET
integrated database retrieval system