Sesamum indicum (sesame): 105160194 Help Entry 105160194         CDS       T04135                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism sind  Sesamum indicum (sesame) Pathway sind03030   DNA replication sind03410   Base excision repair sind03420   Nucleotide excision repair sind03430   Mismatch repair sind03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105160194    03410 Base excision repair     105160194    03420 Nucleotide excision repair     105160194    03430 Mismatch repair     105160194    03440 Homologous recombination     105160194  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sind03032]     105160194    03400 DNA repair and recombination proteins [BR:sind03400]     105160194 DNA replication proteins [BR:sind03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     105160194 DNA repair and recombination proteins [BR:sind03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       105160194    MMR (mismatch excision repair)     DNA polymerase delta complex      105160194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  105160194 NCBI-ProteinID:  XP_011075763 UniProt:  A0A6I9T5T2 LinkDB All DBs Position LG4:complement(8163320..8164785) Genome browser AA seq 119 aa AA seqDB search MASSDMKGFFRQKKKLGISKPKSSKRSPKPKHSASCGSHLVQPPALVSHGFFDLQDEYDD KEEVLRQFDMNMAYGPCLGMSRLDRWERANALGLHPPKEVENLLRAGKVNSECLWDGRV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgtcttccgatatgaagggtttcttccgacagaagaagaaattgggcatttcaaag ccaaaatcatcaaagagatctccgaagccaaagcattcagcctcctgcggctcccacctc gtccagcctcccgctctcgtttcccatggctttttcgatcttcaagatgagtatgatgac aaagaggaggttctaaggcaatttgacatgaacatggcttatgggccatgcttagggatg agcagactggaccgctgggagcgggcaaatgccttgggcttgcaccctccgaaagaagtt gaaaatctgctgcgggcagggaaggtcaactctgaatgcttgtgggatggtcgtgtttag

DBGET integrated database retrieval system