Sesamum indicum (sesame): 105165279 Help Entry 105165279         CDS       T04135                                  Name (RefSeq) sm-like protein LSM2 isoform X1   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism sind  Sesamum indicum (sesame) Pathway sind03018   RNA degradation sind03040   Spliceosome Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     105165279   09123 Folding, sorting and degradation    03018 RNA degradation     105165279  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sind03019]     105165279    03041 Spliceosome [BR:sind03041]     105165279 Messenger RNA biogenesis [BR:sind03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      105165279   mRNA degradation factors    5'-3' decay     Lsm complex      105165279 Spliceosome [BR:sind03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     105165279  Complex C   U2 snRNP components     105165279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX Gemin7 Motif Other DBs NCBI-GeneID:  105165279 NCBI-ProteinID:  XP_020550374 UniProt:  A0A8M8V232 LinkDB All DBs Position LG6:20762671..20765767 Genome browser AA seq 102 aa AA seqDB search MLSCMEMCVQLFLSVFKDLVGSEVTVELKDDLAVRGTLHAVDQFLNFKLVNVRVVDPDKH PHMFSVQNCFIRGSAVRYVQLPPNEVDVELLQDATRREARSS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgttgagttgcatggagatgtgtgtacagttgttcctctcggttttcaaggatttagtg ggtagtgaagtgacggtggaattgaaggacgatttagcggtgagaggaactctgcatgcg gtggatcagtttcttaacttcaagcttgtaaacgtcagggtcgttgatccagataagcat cctcatatgttttctgtacagaattgcttcatcaggggatctgcagtcaggtacgtccag ttgccacctaatgaagttgatgtagaacttcttcaagatgccaccagaagagaagctcga agcagctaa

DBGET integrated database retrieval system