Sesamum indicum (sesame): 105168051 Help Entry 105168051         CDS       T04135                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism sind  Sesamum indicum (sesame) Pathway sind03018   RNA degradation sind03040   Spliceosome Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     105168051   09123 Folding, sorting and degradation    03018 RNA degradation     105168051  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sind03019]     105168051    03041 Spliceosome [BR:sind03041]     105168051 Messenger RNA biogenesis [BR:sind03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      105168051   mRNA degradation factors    5'-3' decay     Lsm complex      105168051 Spliceosome [BR:sind03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     105168051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  105168051 NCBI-ProteinID:  XP_011086268 UniProt:  A0A6I9TXR8 LinkDB All DBs Position LG8:9107748..9110907 Genome browser AA seq 99 aa AA seqDB search MSGRKETVLDLAKFVNKGVQVKLDGGRQVTGTLKGYDHLLNLVLDEAIEFLRDPDDPLKT TDQTRRLGLIVCRGTAVMLVSGSDGTAEIANPFVQPDGA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgaaaagaaacagttttggatttggcgaagtttgtcaacaagggtgtccaa gtcaagttagatggtggaagacaagtgactgggacgttaaaaggatatgaccatttgctg aatcttgttttggatgaagcaattgaatttctcagagaccctgatgatccactgaaaact actgaccagacgcggcgccttggcttaatagtgtgtcgggggactgccgtgatgcttgtt tccggcagcgacgggacagctgagattgccaacccatttgtccagccggatggggcgtag

DBGET integrated database retrieval system