Sesamum indicum (sesame): 105170020 Help Entry 105170020         CDS       T04135                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sind  Sesamum indicum (sesame) Pathway sind03030   DNA replication sind03082   ATP-dependent chromatin remodeling sind03410   Base excision repair sind03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105170020    03410 Base excision repair     105170020    03420 Nucleotide excision repair     105170020   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105170020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sind03032]     105170020    03036 Chromosome and associated proteins [BR:sind03036]     105170020    03400 DNA repair and recombination proteins [BR:sind03400]     105170020 Enzymes [BR:sind01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      105170020 DNA replication proteins [BR:sind03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     105170020 Chromosome and associated proteins [BR:sind03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     105170020 DNA repair and recombination proteins [BR:sind03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       105170020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP Motif Other DBs NCBI-GeneID:  105170020 NCBI-ProteinID:  XP_011088898 UniProt:  A0A6I9U4Y3 LinkDB All DBs Position LG9:complement(710587..713462) Genome browser AA seq 157 aa AA seqDB search MAEKDKELTEKVVPEAEELPKTIVRRVVKEKLSQLATDSEISVLRDSLQAFCESARIFIH YLSATANDICRESNRQIINAEDVFKALEEIEFAEFIGPLRACLEEFRQKNPGRKVASSGS SKAKDTSKNAKRKPPAQSEGRKKRREVESNRDEDDAD NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggcggagaaggacaaggagttgacggagaaggtagtgccggaagcggaggagctcccc aagactattgtgcgccgggtggtcaaggagaagctctcccagcttgccaccgactccgag atctctgtactccgcgactcactccaggccttctgtgagagtgcccgcatcttcatccac tacctttccgccactgcgaatgacatatgtagggagtcaaacaggcaaataatcaatgcg gaagatgtattcaaggccctggaagagattgagtttgctgagtttattggccctcttaga gcttgcctcgaagagtttagacaaaagaaccctgggaggaaggtggcttcatcaggatca tccaaggccaaagacacaagcaagaatgccaaaaggaaaccacctgcacaaagtgagggt cgaaagaaacgacgtgaagttgaaagcaacagggacgaggatgatgcggattga

DBGET integrated database retrieval system