Sesamum indicum (sesame): 105170724 Help Entry 105170724         CDS       T04135                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism sind  Sesamum indicum (sesame) Brite KEGG Orthology (KO) [BR:sind00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sind03041]     105170724   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sind04052]     105170724 Spliceosome [BR:sind03041]  Complex B   Other components    Complex B specific factors     105170724 Cytokines and neuropeptides [BR:sind04052]  Neuropeptides   Unclassified    105170724 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  105170724 NCBI-ProteinID:  XP_011089917 UniProt:  A0A6I9U7Q1 LinkDB All DBs Position LG9:5551045..5553318 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtagtgttgaatgatcggctgggtaagaaggtgcgtgtcaagtgcaacgag gacgacacaatcggtgacctcaagaagctcgtggccgcccagactggcacccgagccgac aagatcagaattcagaagtggtacaccatctacaaggaccatatcaccctcaaggactac gagatccatgacggcatgggtctcgagttgtactacaactag

DBGET integrated database retrieval system