Sesamum indicum (sesame): 105173458 Help Entry 105173458         CDS       T04135                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sind  Sesamum indicum (sesame) Pathway sind04145   Phagosome sind04148   Efferocytosis sind04620   Toll-like receptor signaling pathway sind05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sind00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105173458    04148 Efferocytosis     105173458  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105173458  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105173458  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sind04131]     105173458   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sind04147]     105173458    04031 GTP-binding proteins [BR:sind04031]     105173458 Membrane trafficking [BR:sind04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105173458  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105173458   Macropinocytosis    Ras GTPases     105173458  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105173458 Exosome [BR:sind04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105173458   Exosomal proteins of other body fluids (saliva and urine)    105173458   Exosomal proteins of colorectal cancer cells    105173458   Exosomal proteins of bladder cancer cells    105173458 GTP-binding proteins [BR:sind04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105173458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Sua5_C AAA_7 B12-binding Motif Other DBs NCBI-GeneID:  105173458 NCBI-ProteinID:  XP_011093501 UniProt:  A0A6I9U0L0 LinkDB All DBs Position LG11:6850413..6853218 Genome browser AA seq 208 aa AA seqDB search MSCSTASNSANAATVTKFIKCVTVGDGAVGKTCLLISYTSNTFPSDYVPTVFDNFSANVS VDGQTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLREDKQFKKDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDAAIKVVLRPPKLKKQKTRYKSCRLL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgagttgtagtactgctagtaatagtgcaaatgctgccacggttaccaaattcattaaa tgtgtgacagttggggatggtgctgttgggaagacatgccttctcatctcctacaccagc aacacctttccatctgattatgttccgactgtttttgataactttagtgccaatgtctct gttgatgggcaaactgtgaatctgggcttgtgggatactgctggtcaagaagactacaac agacttaggccacttagttacagaggagccgatgttttcctccttgcattctctctcata agtaggccaagctttgagaacatatcgaagaaatgggtcccggagctacggcattatgct ccctcagtgcccattgttcttgtggggacaaaactagatctaagagaggataagcagttc aaaaaggattatccaggggcatgcactatttccaccgaacagggtgaagagctgaagaag caaataggagcagtggcctatgttgagtgcagcgccaagacgcagcagaacgttaaggcc gtgtttgacgcggcgataaaggtggtcctccggcctccgaagctgaagaagcagaaaaca agatacaaatcatgccgccttctttaa

DBGET integrated database retrieval system