Sesamum indicum (sesame): 105173476 Help Entry 105173476         CDS       T04135                                  Name (RefSeq) sm-like protein LSM7 isoform X1   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism sind  Sesamum indicum (sesame) Pathway sind03018   RNA degradation sind03040   Spliceosome Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     105173476   09123 Folding, sorting and degradation    03018 RNA degradation     105173476  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sind03019]     105173476    03041 Spliceosome [BR:sind03041]     105173476 Messenger RNA biogenesis [BR:sind03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      105173476   mRNA degradation factors    5'-3' decay     Lsm complex      105173476 Spliceosome [BR:sind03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     105173476 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq KNOX2 Motif Other DBs NCBI-GeneID:  105173476 NCBI-ProteinID:  XP_011093527 UniProt:  A0A6I9U815 LinkDB All DBs Position LG11:complement(7047792..7051036) Genome browser AA seq 99 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAIEFLRDPEDPLKT TDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFVQPDGA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcagaaaggaaacagttttggatttagcgaaattcgtggacaagggtgtccaa gtcaaactaactggtggaagacaagtgactggaactctgaaagggtatgaccaattgctg aatcttgttctggatgaagcgatagaatttcttagagatccagaagatccgctgaagact actgaccagacccgtcgccttggcctcatagtttgccgcggaactgctgtgatgcttgtt tccccaacagatggcacagatgaaatcgccaatccattcgtccagcctgatggggcttag

DBGET integrated database retrieval system