Sesamum indicum (sesame): 11452384 Help Entry 11452384          CDS       T04135                                  Symbol atpH, SIC0145 Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism sind  Sesamum indicum (sesame) Pathway sind00190   Oxidative phosphorylation sind00195   Photosynthesis sind01100   Metabolic pathways Module sind_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sind00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     11452384 (atpH)    00195 Photosynthesis     11452384 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sind00194]     11452384 (atpH) Photosynthesis proteins [BR:sind00194]  Photosystem and electron transport system   F-type ATPase [OT]    11452384 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  11452384 NCBI-ProteinID:  YP_004935653 UniProt:  G9IB49 LinkDB All DBs Position Pltd:complement(13732..13977) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgctgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggagttggtcaagggactgctgcaggtcaagccgtagagggtatcgcg agacagcccgaggcagagggaaaaatacgaggtactctattgcttagtctagcttttatg gaagctttaacgatttatggattggttgtagcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system