Streptomyces inhibens: KI385_22550 Help Entry KI385_22550       CDS       T08140                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sine  Streptomyces inhibens Pathway sine00998   Biosynthesis of various antibiotics sine01100   Metabolic pathways sine01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sine00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI385_22550    00074 Mycolic acid biosynthesis     KI385_22550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI385_22550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7387 Motif Other DBs NCBI-ProteinID:  UKY55294 LinkDB All DBs Position complement(4922442..4922687) Genome browser AA seq 81 aa AA seqDB search MTREEIVAQLAEILNEVAGVLPSEVTEEKSLVEELDVDSLAMAEVIVVAEERFGVALPEE EMKDMRRVLDIVLRVEKQLAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgaagagatcgttgctcaactcgccgagatccttaacgaggtggccggcgtg ctgccgtccgaggtgaccgaggagaagtccctggtcgaggagttggacgtggactccctc gcgatggccgaggtcatcgtcgtcgccgaggagcgcttcggcgtcgcgctgcccgaagag gagatgaaggacatgcgtagagttttggacattgtgctcagggtggagaagcagctggcg tcctga

DBGET integrated database retrieval system