Singulisphaera sp. Ch08: V5E97_00290 Help Entry V5E97_00290       CDS       T11449                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism sing  Singulisphaera sp. Ch08 Brite KEGG Orthology (KO) [BR:sing00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sing03110]     V5E97_00290 (groES)    03029 Mitochondrial biogenesis [BR:sing03029]     V5E97_00290 (groES) Chaperones and folding catalysts [BR:sing03110]  Heat shock proteins   HSP10    V5E97_00290 (groES) Mitochondrial biogenesis [BR:sing03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     V5E97_00290 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 HIRA_B Motif Other DBs NCBI-ProteinID:  XBH04487 UniProt:  A0AAU7CHS3 LinkDB All DBs Position complement(80663..80953) Genome browser AA seq 96 aa AA seqDB search MNLKPLGDRVVVEREEAKGTTAGGIVLPDTAKDKPQKGKVLAVGDGRITKDGKRRELQVK VGDQVLFTSYAGDEFKIEGDQKVLLMREDDILAVID NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatctcaagccgttgggcgatcgcgtggtggtcgagcgagaagaagcgaaggggacg accgccggggggatcgtgctgcccgacactgccaaggacaagccgcagaaggggaaggtc ctcgccgtgggagatgggcggatcaccaaggacggcaagcgccgcgagctgcaggttaag gtcggcgatcaggttctgttcacgtcctatgcgggggacgagttcaagattgaaggggac cagaaggttctcctgatgcgtgaagacgacatcctggcggtcattgactga

DBGET integrated database retrieval system