Sinimarinibacterium sp. NLF-5-8: GT972_09020 Help Entry GT972_09020       CDS       T06400                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism sini  Sinimarinibacterium sp. NLF-5-8 Brite KEGG Orthology (KO) [BR:sini00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sini03036]     GT972_09020 (ftsL) Chromosome and associated proteins [BR:sini03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GT972_09020 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF2681 CCDC144C DUF4164 MIC19_MIC25 APG6_N DUF3263 LapA_dom FAZ1_C Seadorna_VP6 HALZ Motif Other DBs NCBI-ProteinID:  QHS10267 UniProt:  A0A6P1UAD7 LinkDB All DBs Position complement(1882398..1882670) Genome browser AA seq 90 aa AA seqDB search MKRGLWMVVLVLGVAVFYSALVVIRTKHENRALVSELEQLRQDRERLEMEWAQLQIEEAT LAHNNRVDKVAREQLGMVEPRDYQVVKAGP NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagcgcggcctgtggatggtggtgctggttctgggcgtggcggtgttttattccgcg ctggtggtgatccgtaccaagcatgaaaaccgcgcgctggtctccgaactggagcagttg cgccaggatcgtgagcgcctggagatggaatgggcgcagttacagatcgaagaagccacg ctggcgcacaacaaccgggtggacaaggtcgcgcgcgagcagctgggcatggtcgagccg cgtgattatcaagtcgtcaaggcggggccgtga

DBGET integrated database retrieval system