Sinimarinibacterium sp. NLF-5-8: GT972_13805 Help Entry GT972_13805       CDS       T06400                                  Name (GenBank) monooxygenase   KO K15763   toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-] Organism sini  Sinimarinibacterium sp. NLF-5-8 Pathway sini00623   Toluene degradation sini01100   Metabolic pathways sini01120   Microbial metabolism in diverse environments sini01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sini00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00623 Toluene degradation     GT972_13805 Enzymes [BR:sini01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.236  toluene 4-monooxygenase      GT972_13805 SSDB OrthologParalogGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QHS11107 LinkDB All DBs Position 2894821..2895135 Genome browser AA seq 104 aa AA seqDB search MMKTNPADAHRNNRVGPVMRAGGITAGVIEAAEEDNPEKVIRVEDKVAYVRIDCDGELIL RRATLERTLGRAFKMSELEVNLASFAGRIETSEDQVRFYYEKTL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgatgaaaaccaatcctgccgacgcgcaccgcaacaatcgcgtcggccccgtcatgcgc gccggtggcatcaccgccggggtgatcgaagcggcagaagaagacaaccccgaaaaagtg atccgggtggaggacaaagtcgcctatgtgcgcatcgactgcgacggcgagctgattctg cgccgtgccacgctggaacggacgctggggcgggctttcaagatgtccgaactggaggtc aacctcgcttcgtttgccggtcgcatcgagaccagcgaagaccaggttcgcttttattac gaaaagaccctttga

DBGET integrated database retrieval system