KEGG   Sinimarinibacterium sp. NLF-5-8: GT972_14855
Entry
GT972_14855       CDS       T06400                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
sini  Sinimarinibacterium sp. NLF-5-8
Brite
KEGG Orthology (KO) [BR:sini00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT972_14855
Enzymes [BR:sini01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     GT972_14855
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: QHS11299
UniProt: A0A6P1UDN1
LinkDB
Position
complement(3131099..3132958)
AA seq 619 aa
MNKHIKRAVRTSFAAALAMTLPGLGYAASGVTWDDIVNDEKTPENILTYGMGVQAQRFST
LEQINTNTVSKLSPVWSFSFGDEKQRGQESQALVYDGVIYVTGSYSRLWALDARTGKRLW
SYQHRLPDDIRPCCDVVNRGAAIYGDKVFFGTLDAAVVALDRKTGKVVWSKKFGDHKVGY
TMTGAPAIIKDQKSGRVMLVHGSSGDEFGVVGKLYARDPDTGEEIWMRPMVEGHMGRLNG
KDSTTTGDIKAPSWPDDKNRPTGKVEAWSQGGGAPWQTPSFDVVNNTIVVGTGNPAPWNT
WQRTPEGGDPMKWDSLYTSGQAYVDPGTGELKGFLAHTPNDGWDFSGNNEIILFDYQKDG
KTIKAGAHADRNGFFFITDREKLSKAGGKIHRQNALLQAYPFVDGITWATGFDLKTGYPN
KVRSQIPPPLKPGQEKGDSIFVSPPFLGGKNWTPMSYNPKTNLFYIPANHWAMDYWTENI
SYNPGAAYLGMGFRIKRLFDDHVGTLRALDPTTGKIVWEHKEELPLWSGTLTTAGNLVFT
GTSDGYVKAFDAKTGAELWKFQTGSGVVSIPVTWTMDGEQYLGIASGYGGAVPLWGGDMA
DLTRRVTQGGSYWVFKLSQ
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaacaaacacatcaaacgcgctgtgcgaacctcgttcgccgccgcgctggcgatgacg
ctgccggggctgggctatgccgcctccggcgtgacctgggatgacatcgtcaacgacgag
aaaacccccgaaaacatcctgacctacgggatgggtgtgcaggcccagcgattcagtacg
ctggagcagatcaacaccaataccgtatccaagctgtctccggtgtggtcgttctcgttc
ggggacgaaaaacagcgtgggcaggaatcacaggcgctggtgtatgacggcgtgatctat
gtgaccggctcctattcgcggctgtgggcactggacgccagaaccggcaagcgcctgtgg
tcataccagcaccgcctgcccgatgacatccgcccctgctgtgacgtggtcaaccggggc
gccgccatttatggcgacaaggtgttcttcggcacgctcgatgccgccgtggtggcgctg
gatcgcaaaaccggcaaagtggtatggagcaagaagtttggcgatcacaaggtcggttac
acgatgaccggcgctccggcgatcatcaaggatcaaaaatcgggacgcgtcatgctcgtc
cacggttcctcgggcgatgaattcggcgtcgtcggcaagctctacgcgcgcgaccccgac
accggcgaagaaatctggatgcgccccatggtcgaaggtcacatgggccgactcaacggc
aaagacagcacaaccaccggtgacatcaaagcgccctcatggccagacgacaaaaaccgt
cccaccggcaaggtcgaagcctggagccagggcggcggtgcaccgtggcagacgccgtca
ttcgacgtggtcaacaacaccatcgtcgtgggcaccggcaaccccgcgccatggaatacc
tggcagcgcacccccgaaggcggcgatcccatgaagtgggacagcctctacacctccgga
caagcctatgtggatccgggtaccggcgagctcaaaggctttctggcacacacgcccaac
gatggctgggatttttccggtaacaacgaaatcatcctgttcgactaccagaaagacggc
aaaaccatcaaggccggcgcgcatgccgaccgcaatggctttttcttcatcaccgaccgc
gaaaagctctccaaggccggcggcaagatccatcgccaaaatgccctgttgcaagcgtat
ccgttcgttgatggcatcacctgggcaaccggctttgatctgaaaaccggctatcccaac
aaagtgcgttcgcaaatcccgccgccactcaagcccggtcaggaaaaaggcgactccatc
ttcgtctcgcctcccttcctcggcggcaagaactggacgccgatgtcctacaacccgaag
accaatctgttctacatccccgccaatcactgggcgatggattactggacggaaaacatc
agctacaaccccggcgcggcgtatctgggcatgggcttccgcatcaagcgcctgttcgac
gatcacgtcggcacgctgcgcgcgctcgatcccaccaccggcaaaatcgtgtgggagcac
aaagaggagctgccgctgtggtcgggaactttgaccaccgctggcaacctcgtctttacc
ggcaccagcgatggctacgtcaaggcatttgacgccaagaccggcgccgaactgtggaaa
ttccagaccggctccggcgtggtatcaatccccgtcacctggaccatggacggcgagcag
taccttggcattgcctcgggttacggcggcgcagttccgctgtggggtggcgatatggcg
gatttgacccgtcgcgtcacccaagggggctcgtactgggtattcaaactcagtcaataa

DBGET integrated database retrieval system