KEGG   Sulfitobacter indolifex: DSM14862_00204
Entry
DSM14862_00204    CDS       T08028                                 
Symbol
petA
Name
(GenBank) Ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
sinl  Sulfitobacter indolifex
Pathway
sinl00190  Oxidative phosphorylation
sinl01100  Metabolic pathways
sinl02020  Two-component system
sinl04148  Efferocytosis
Module
sinl_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:sinl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DSM14862_00204 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSM14862_00204 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    DSM14862_00204 (petA)
Enzymes [BR:sinl01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     DSM14862_00204 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske Ribosomal_TL5_C UCR_TM
Other DBs
NCBI-ProteinID: UOA17457
LinkDB
Position
cDSM14862:210565..211125
AA seq 186 aa
MSQAEEHAGTRRDFLYYATAGTGAVAVGAAVWPLVNQMNPSADVKALSSIRVDVSGVEVG
TQLTVKWLGKPVFIRRRTEAEIEEAKAVDVSTLPDPIAQNENLSGDVPATDENRALDETG
EWLVQMGVCTHLGCVPLGDAGDFGGWFCPCHGSHYDTAGRIRKGPAPRNLPVPVAEFVDE
STIKLG
NT seq 561 nt   +upstreamnt  +downstreamnt
gtgtcccaagcagaagaacacgcaggcacccggagggatttcctgtattacgcgacagcc
ggtacaggtgccgtcgccgttggtgccgccgtctggccgctggtcaaccagatgaacccc
tctgccgacgtaaaggcgctgtcgtccatccgtgtggatgtgtccggcgttgaagtcggg
acgcagctgactgtgaagtggctgggcaagccggtgttcattcgccgccgcaccgaagcc
gagatcgaagaggcgaaagccgtcgatgtatcgacgctgcccgatccgatcgcgcagaac
gagaacctcagcggcgacgtgcctgccacggacgagaaccgcgcgttggatgaaactggc
gaatggctggttcagatgggcgtttgtacgcaccttggctgtgtgcctttgggtgatgcg
ggtgactttggcggctggttctgcccctgccacgggtcgcactacgacaccgcaggccgc
atccgtaaagggccggccccacgcaacttgccggtgcctgtcgccgaattcgtggacgag
tccacgattaaactgggttaa

DBGET integrated database retrieval system