KEGG   Sulfitobacter indolifex: DSM14862_00428
Entry
DSM14862_00428    CDS       T08028                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
sinl  Sulfitobacter indolifex
Brite
KEGG Orthology (KO) [BR:sinl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sinl03016]
    DSM14862_00428 (truB)
Enzymes [BR:sinl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     DSM14862_00428 (truB)
Transfer RNA biogenesis [BR:sinl03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    DSM14862_00428 (truB)
 Prokaryotic type
    DSM14862_00428 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 DKCLD
Other DBs
NCBI-ProteinID: UOA17677
LinkDB
Position
cDSM14862:complement(434550..435476)
AA seq 308 aa
MARKRKGRDISGWLVVDKPAGPTSTAVVNKVRWALEAKKAGHAGTLDPEATGVLAIALGE
ATKTVPYITDALKAYEFTVRLGISTNTDDAEGEVIGTSDLRPDDAAIKDALSDFIGDIQQ
VPPQFSAVKIDGQRAYKRARDGEEMDIAARPLWVESLLLLDRPDADHVTLEMVCGKGGYV
RSIARDLGQKLGCLGHVRELRRTWSGPFEASNALTLAQIDEIARTPELDTHLLPLAEGLV
ELPEVKATPEGATRLRNGNPGMVIAHDVEYGDECWASLDGQPVAVGRFKAGELHPSRVFN
LSSDTNEG
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcacgcaaacgcaagggtcgcgatatttccggctggctggttgtagataaacccgct
ggaccgacatcgaccgccgtggtcaacaaggtccgctgggcgcttgaagcgaaaaaggca
ggccacgcgggcacgctggaccctgaagccaccggcgttctggccatcgccttgggcgaa
gcgaccaagaccgtgccctacatcactgacgcgctcaaagcttatgagtttaccgtgcgt
ttggggatttccaccaacaccgacgacgccgagggcgaggtcatcggcacttccgacctg
cgccccgacgatgcggcgattaaggatgcgctgagcgatttcatcggggacatccaacaa
gtcccgccacagttctctgccgtgaagattgacggtcagcgcgcctataaacgcgcccgc
gacggcgaagagatggacatcgccgcgcgtccgctctgggtggaaagcctgctgctgctc
gaccggcccgatgcggatcacgtcacgcttgagatggtctgcggcaagggcggctatgtc
cgctccatcgcccgcgatctggggcaaaaacttggctgcctcggccacgtccgcgagctg
cgccgcacatggtctggcccgtttgaggcctcgaatgccctgacactggcacagatcgac
gagatcgcccgcacgccagaactcgacacgcatctgctgccgctggccgaaggattggtt
gagttgcccgaggtcaaagccacccccgaaggcgcgacgcgcctgcgcaacggcaacccc
ggcatggtaatcgcccatgacgtggaatacggcgatgaatgctgggcctcgctggacggt
cagcccgtcgccgtgggccgcttcaaagcaggcgagttgcaccccagccgggtcttcaac
ctatcttcggacacgaacgagggctaa

DBGET integrated database retrieval system