Sulfitobacter indolifex: DSM14862_01400 Help Entry DSM14862_01400    CDS       T08028                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism sinl  Sulfitobacter indolifex Pathway sinl02024   Quorum sensing sinl03018   RNA degradation Brite KEGG Orthology (KO) [BR:sinl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DSM14862_01400 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DSM14862_01400 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sinl03019]     DSM14862_01400 (hfq)    03036 Chromosome and associated proteins [BR:sinl03036]     DSM14862_01400 (hfq) Messenger RNA biogenesis [BR:sinl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DSM14862_01400 (hfq) Chromosome and associated proteins [BR:sinl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DSM14862_01400 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UOA18628 LinkDB All DBs Position cDSM14862:1417790..1418029 Genome browser AA seq 79 aa AA seqDB search MASDRQNLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRRDGQSQLVYKHA ISTIMPSQPISLYEGEDAS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcgtcagacagacagaaccttcaggatgcgttcctaaaccacgtccgcaagaccaag gtcccggtaaccatttttctgatcaatggggttaagctgcaaggcgtcattacctggttt gataatttttgcgttctgctgcgccgtgatggccaatcgcaacttgtctacaagcatgcg atttcgaccattatgccaagccagccgatcagcctttatgagggcgaagacgcttcttga

DBGET integrated database retrieval system