Streptomyces incarnatus: ABB07_12330 Help Entry ABB07_12330       CDS       T09785                                  Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sinn  Streptomyces incarnatus Pathway sinn00190   Oxidative phosphorylation sinn01100   Metabolic pathways Module sinn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sinn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ABB07_12330  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sinn00194]     ABB07_12330 Photosynthesis proteins [BR:sinn00194]  Photosystem and electron transport system   F-type ATPase [OT]    ABB07_12330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AKJ10773 LinkDB All DBs Position complement(2848058..2848297) Genome browser AA seq 79 aa AA seqDB search MAATETLAAVSGSIGSVGYGLSAIGPGIGVGIIFGNGTQALARQPEAAGLIRANQILGFA FCEALALIGIVMPFVFGTK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggctgccactgagaccctcgccgctgtctccggttccatcggttctgtcggttacggc ctctccgccatcggccccggcatcggcgtcggcatcatcttcggtaacggcacccaggcc ctcgcccgtcagcccgaggccgcgggtctgatccgcgccaaccagatcctcggtttcgcc ttctgtgaggcgctcgccctgatcggcatcgtcatgccgttcgtgttcggtacgaagtaa

DBGET integrated database retrieval system