KEGG   Streptomyces incarnatus: ABB07_14940
Entry
ABB07_14940       CDS       T09785                                 
Name
(GenBank) ATP-dependent DNA helicase PcrA
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sinn  Streptomyces incarnatus
Pathway
sinn03420  Nucleotide excision repair
sinn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sinn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ABB07_14940
   03430 Mismatch repair
    ABB07_14940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinn03400]
    ABB07_14940
Enzymes [BR:sinn01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     ABB07_14940
DNA repair and recombination proteins [BR:sinn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     ABB07_14940
   MMR (mismatch excision repair)
    Other MMR factors
     ABB07_14940
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PcrA_UvrD_tudor UvrD_C_2 AAA_30 AAA_11 ResIII DEAD
Other DBs
NCBI-ProteinID: AKJ11275
UniProt: A0ABN4GCC2
LinkDB
Position
complement(3425864..3428356)
AA seq 830 aa
MSSLFDDSFLADLQAPRGHEEEPPPPPEDDHAPEPLPDDLFGGKFDMPPDRDTHYRDGAP
RPAIDSAALLEGLNDNQRAAVVHAGSPLLIVAGAGSGKTRVLTHRIAYLLAERHVHPGQI
LAITFTNKAAGEMKERVEHLVGPRANVMWVMTFHSACVRILRRESKKLGFTSSFSIYDAA
DSKRLMALVCRDLDLDPKRFPPKSFSAKISNLKNELIDEEDFAAQATDGFEKTLAQAYAL
YQSRLREANALDFDDLIMTTVNLLRAFPDVAEHYRRRFRHVLVDEYQDTNHAQYALVREL
VGTAERPADEGDTPTGEYDIPPAELCVVGDADQSIYAFRGATIRNILQFEEDYADATTIL
LEQNYRSTQTILSAANAVIERNESRRPKNLWTNAGQGARITGYVADTEHDEAQFVADEID
RLVDAGEARAGDVAVFYRTNAQSRVFEEVFIRVGLPYKVVGGVRFYERKEVRDVLAYLRV
LANPEDSVPLRRILNVPKRGIGERAEAMIDALAQRERISFPQALKRVDEAYGMAARSTNA
VKRFNTLMEDLRTIVESGAGPATVLEAVLERTGYLAELQTSTDPQDETRIENLQELAAVA
LEFEQERGEGESVGLADFLEQVALVADSDQIPDEDEDGSGVITLMTLHTAKGLEFPVVFL
TGMEDGVFPHMRALGQTKELEEERRLAYVGITRARERLYLTRSAMRSAWGQPSYNPPSRF
LEEIPPTHVDWKRTGATAPVSSGPASGIAASLSSTRSRSSASGASGFATRRTSEKPVVAL
AVGDRVTHDQFGLGTVVAVKGTGANAEATIDFGDAKPKRLLLRYAPVEKL
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgagcagcctctttgacgacagcttcctggcggacctccaggcccctcgcgggcacgag
gaggagcccccgccgccgcccgaggacgatcacgctccggagccgcttccggacgatctg
ttcggcgggaagttcgacatgccgccggaccgggacacccactaccgcgacggcgcgccc
cgccccgcgatcgactcggcggcgctgctggaggggctgaacgacaaccagcgcgcggcg
gtcgtgcacgccggctccccgctgctcatcgtcgccggcgccggctccggcaagacccgc
gtgctcacccaccgcatcgcgtacctgctcgccgagcggcatgtgcaccccggccagatc
ctcgcgatcaccttcaccaacaaggccgcgggcgagatgaaggagcgcgtcgagcacctc
gtcggcccgcgcgcgaacgtgatgtgggtgatgaccttccacagcgcgtgcgtgcgcatc
ctgcgccgcgagtcgaagaagctcggcttcacgtcgtcgttctcgatctacgacgccgcc
gacagcaagcgtctgatggccctggtctgccgcgacctggacctcgacccgaagcgcttc
ccgccgaagtccttcagcgcgaagatcagcaatctgaagaacgagctgatcgacgaggag
gacttcgccgcccaggccaccgacggcttcgagaagaccctcgcccaggcctacgcgctc
taccagtcgcggctccgcgaggccaacgcgctcgacttcgacgacctgatcatgacgacg
gtcaacctgctgcgcgccttcccggacgtcgccgagcactaccgccgccgcttccggcac
gtcctggtcgacgagtaccaggacaccaaccacgcccagtacgcactcgtacgggaactc
gtcggcacggcagagcgccccgccgacgagggcgacaccccgaccggcgagtacgacatc
ccgccggccgagctgtgcgtcgtgggtgacgccgaccagtcgatctacgccttccggggc
gcgaccatccgcaacatcctccagttcgaggaggactacgcggacgcgacgacgatcctg
ctggagcagaactaccgctccacgcagaccatcctgtccgcggccaacgcggtcatcgag
cgcaacgagtcccgccgcccgaagaacctgtggaccaacgccgggcagggagcgcggatc
accggttacgtcgcggacaccgagcacgacgaggcccagttcgtcgccgacgagatagac
cgcctggtcgacgcgggcgaggccagggcgggcgacgtcgccgtcttctaccgcaccaac
gcgcagtcccgtgtcttcgaagaggtcttcatccgcgtcggcctgccctacaaggtcgtc
ggcggcgtccgcttctacgaacgcaaggaggtccgggacgtcctcgcctacctgcgcgtc
ctcgccaacccggaggactcggtgccgctgcgccgcatcctcaacgtgcccaagcggggc
atcggtgagcgcgcggaggcgatgatcgacgccctcgcccagcgcgagaggatcagcttc
ccgcaggcgctcaagcgcgtggacgaggcgtacggcatggccgcgcgctccaccaacgcc
gtcaagcggttcaacacgctgatggaggacctgcgtacgatcgtggagtccggagccggt
ccggccaccgtcctggaggccgtgctcgaacggaccgggtatctggccgaactgcagacc
tccaccgacccgcaggacgagacccgcatcgagaacctccaggaactcgcggcggtggcc
ctggagttcgagcaggagcgcggtgagggcgagtcggtggggctggccgacttcctggag
caggtggccctggtcgccgactccgaccagatccccgacgaggacgaggacggctccgga
gtcatcaccctgatgaccctgcacaccgccaagggcctggagttcccggtcgtcttcctg
accggcatggaggacggcgtcttcccgcacatgcgcgccctcggccagaccaaggagctg
gaggaggagcgccgcctggcgtacgtcggcatcacgcgcgcgcgggagcggctctacctc
acgcggtcggccatgcgcagcgcctggggccagccgtcgtacaacccgccctcccgcttc
ctggaggagatcccgcccacccatgtggactggaagcggacgggagcgacggcaccggtc
tcgtccggtcccgcgtccgggatcgcggcctcgctgtcctcgacccgctcgcgttcctcg
gcgtcgggcgcgtccgggttcgccacccggcgcacctcggagaagccggtggtcgccctg
gccgtcggggaccgggtcacccacgaccagttcgggctcggcacggtcgtcgccgtgaag
ggcacgggtgcgaacgcggaggcgacgatcgacttcggcgacgccaagccgaagcggctg
ctgctgcggtacgcgccggtggagaagctgtaa

DBGET integrated database retrieval system