KEGG   Streptomyces incarnatus: ABB07_37390
Entry
ABB07_37390       CDS       T09785                                 
Name
(GenBank) hypothetical protein
Organism
sinn  Streptomyces incarnatus
SSDB
Motif
Pfam: RPW8 FAA_hydro_N_2 SlpA_D2 KPBB_C Phage_Mu_Gam RsmF-B_ferredox Acyl-CoA_dh_C Prominin
Other DBs
NCBI-ProteinID: AKJ15536
UniProt: A0ABM5TX79
LinkDB
Position
complement(8320726..8321211)
AA seq 161 aa
MSVMTGTQPQQQFGQQIGAPQGQLAQVVQQAIQQACQQASQQIAQRMQQTLQQIQQVQQQ
LQQQGMAHQAHPYLALALHHTLQQGVRSAVEQSVQQALPTAIVTLLQQSQQSQQGAQGMQ
GMQGMQQWGGGYGPQSFGQQLPQYQQPGFGFGQMGQPFGIG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcggtgatgaccggtacccagccccagcagcagttcggccagcagatcggcgccccg
cagggccagctcgcacaggtggtccagcaggcgatccagcaggcctgccagcaggcgagc
cagcagatcgcgcagcgcatgcagcagacgctgcagcagatccagcaggtccagcagcag
ctgcagcagcagggcatggcccaccaggcgcacccctacctcgcgctcgcgctgcaccac
acgctgcagcagggcgtccgcagcgcagtcgagcagtccgtgcagcaggcgctgccgacg
gcgatcgtgacgctcctccagcagagccagcagagccagcagggggcccagggcatgcag
ggcatgcagggcatgcagcagtggggcggcgggtacggcccgcagtcgttcgggcagcag
ctcccgcagtaccagcagcccggcttcggcttcggccagatgggtcagcccttcggcatc
ggctga

DBGET integrated database retrieval system