Streptomyces incarnatus: ABB07_39100 Help Entry ABB07_39100       CDS       T09785                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism sinn  Streptomyces incarnatus Pathway sinn00261   Monobactam biosynthesis sinn01100   Metabolic pathways sinn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sinn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABB07_39100  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sinn01008]     ABB07_39100 Polyketide biosynthesis proteins [BR:sinn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABB07_39100 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKJ15822 UniProt:  A0A0G3ATW3 LinkDB All DBs Position unnamed_1:85624..85839 Genome browser AA seq 71 aa AA seqDB search MSANPFDDEDGRFYVVVNDEEQHSLWPVFAEVPAGWRVVFGEAARAECLEYVERNWTDLR PRSLREAMAAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ttgagcgctaaccccttcgacgacgaggacggccgcttctacgtcgtggtcaacgacgag gagcagcactccctgtggccggtgttcgccgaggtgccggcgggctggcgggtggtcttc ggtgaggcggcccgggccgagtgcctggagtacgtcgagcggaactggaccgacctgcgc cccaggagcctgcgcgaggcgatggcggcggactga

DBGET integrated database retrieval system