Sulfurovum indicum: IMZ28_01520 Help Entry IMZ28_01520       CDS       T07193                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sinu  Sulfurovum indicum Pathway sinu01100   Metabolic pathways sinu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sinu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IMZ28_01520 (acpP)    00074 Mycolic acid biosynthesis     IMZ28_01520 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IMZ28_01520 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QOR62184 UniProt:  A0A7M1S4S0 LinkDB All DBs Position 284493..284726 Genome browser AA seq 77 aa AA seqDB search MALFDDVKEVVVEQLNVSPDEVKEESKFVEDLGADSLDVVELVMALEEKFDIEIPDDQAE AIATVADAIKFIENANA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcattatttgatgatgtaaaagaggtagttgttgagcaactgaatgtgagcccggat gaggtaaaagaagagtctaagttcgtagaggaccttggggctgacagtcttgatgtcgtt gaattggtaatggcgcttgaagagaaatttgatattgaaattcctgatgatcaggcggaa gcgatcgcaactgtagcagatgccatcaaatttatcgagaatgcaaacgcataa

DBGET integrated database retrieval system