Saccharolobus islandicus L.S.2.15: LS215_1800 Help Entry LS215_1800        CDS       T00889                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sis  Saccharolobus islandicus L.S.2.15 Pathway sis03010   Ribosome Brite KEGG Orthology (KO) [BR:sis00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LS215_1800   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LS215_1800  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sis03011]     LS215_1800    04121 Ubiquitin system [BR:sis04121]     LS215_1800   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sis04147]     LS215_1800 Ribosome [BR:sis03011]  Ribosomal proteins   Eukaryotes    Small subunit     LS215_1800   Archaea     LS215_1800 Ubiquitin system [BR:sis04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LS215_1800 Exosome [BR:sis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LS215_1800   Exosomal proteins of colorectal cancer cells    LS215_1800 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB YPEH2ZP Zn_ribbon_RPB9 Zn_ribbon_Nudix Zn_ribbon_PriA UPF0179 Zn_Ribbon_1 Lar_restr_allev YhfH FlhC DUF7838 DUF5795 Zn_ribbon_3 ComFA_N DUF1451 Zn_ribbon_13 DUF6758 Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  ACP35796 LinkDB All DBs Position 1646563..1646754 Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKVKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGTS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaagaacttattacgtaattgaagggaat aaggttaagctaaaaaataagaaatgtcctagatgcggaagtataatggctcaccactta aaaccaaatgagagatggtcttgtggaaaatgtggttacactgagtttataggcacttca aagaaaagataa

DBGET integrated database retrieval system