Setaria italica (foxtail millet): 101752686 Help Entry 101752686         CDS       T02818                                  Name (RefSeq) SKP1-like protein 18   KO K03094   S-phase kinase-associated protein 1 Organism sita  Setaria italica (foxtail millet) Pathway sita03083   Polycomb repressive complex sita04120   Ubiquitin mediated proteolysis sita04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sita00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101752686    04120 Ubiquitin mediated proteolysis     101752686   09126 Chromosome    03083 Polycomb repressive complex     101752686  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sita04131]     101752686    04121 Ubiquitin system [BR:sita04121]     101752686    03036 Chromosome and associated proteins [BR:sita03036]     101752686 Membrane trafficking [BR:sita04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101752686 Ubiquitin system [BR:sita04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101752686    Cul7 complex      101752686 Chromosome and associated proteins [BR:sita03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101752686   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101752686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  101752686 NCBI-ProteinID:  XP_004963787 LinkDB All DBs Position III:complement(22027602..22027895) Genome browser AA seq 97 aa AA seqDB search MSRVLQYLNKKHSGGGAFAAVEVKEFEKAFFEKMTKEALFDVILAANYLHAEKLLDAAMV CVADRIMGKTVPELREYFGIEIDFTPEEEEEIRKENS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtccagggtgctccagtacctcaacaagaagcatagcggcggcggcgcgtttgcggcc gtggaggttaaggagttcgagaaggccttcttcgagaagatgacgaaggaggcgctgttc gacgtgatcctggcggccaactacctccatgcggagaagctgctggacgcggcgatggtg tgcgtcgcggacaggattatgggaaagacggtgccggagcttcgggagtacttcggcatc gagatcgacttcacccccgaggaggaggaagagatcaggaaggagaactcctag

DBGET integrated database retrieval system