Setaria italica (foxtail millet): 101760620 Help Entry 101760620         CDS       T02818                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sita  Setaria italica (foxtail millet) Pathway sita03030   DNA replication sita03082   ATP-dependent chromatin remodeling sita03410   Base excision repair sita03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sita00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101760620    03410 Base excision repair     101760620    03420 Nucleotide excision repair     101760620   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101760620  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sita03032]     101760620    03036 Chromosome and associated proteins [BR:sita03036]     101760620    03400 DNA repair and recombination proteins [BR:sita03400]     101760620 Enzymes [BR:sita01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101760620 DNA replication proteins [BR:sita03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101760620 Chromosome and associated proteins [BR:sita03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     101760620 DNA repair and recombination proteins [BR:sita03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101760620 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP TAF Motif Other DBs NCBI-GeneID:  101760620 NCBI-ProteinID:  XP_004956211 UniProt:  K3ZXF6 LinkDB All DBs Position II:complement(15465385..15467349) Genome browser AA seq 173 aa AA seqDB search MARKRTKEAEPQPAAAAQEEPAPAPAAPAAAMTEAEVEELPKAIVRRLVKDKLAHIAGGG EGAEVIVNKDAMAAFAESARIFIHYLSATANDMCKESKRQTINADDVLNALDEMDFPEFV EPLRTSLQEFRNKNADRRSEANKKQKEKRRKLNEEPHPQNENDPVDDAKEDDD NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggcgcggaagcggacgaaggaagccgaaccccagccggcggcggccgcgcaagaggag cccgctccggcaccggcggcgccggcggccgcgatgaccgaggcggaggtggaggagctg cccaaggccatcgtgcgccgcctggtcaaggacaagctcgcccacatcgccggcggcggg gaaggagcggaggtcatcgtcaacaaggacgccatggccgcgttcgccgagagcgcccgc atcttcatccactacctctccgccactgccaatgatatgtgcaaagaatcaaagaggcag accatcaatgctgatgatgtcctcaatgcgcttgacgagatggactttccagagtttgta gagccccttaggacctcactgcaagagttcagaaacaaaaatgcagatagaaggtcagaa gcaaacaaaaagcaaaaggaaaagagaaggaaactaaatgaagagcctcatccgcagaac gaaaatgatccagttgatgatgccaaggaggatgacgattag

DBGET integrated database retrieval system