Setaria italica (foxtail millet): 101769255 Help Entry 101769255         CDS       T02818                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sita  Setaria italica (foxtail millet) Pathway sita04145   Phagocytosis sita04148   Efferocytosis sita04517   IgSF CAM signaling sita04518   Integrin signaling sita04519   Cadherin signaling sita04620   Toll-like receptor signaling pathway sita05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sita00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101769255    04518 Integrin signaling     101769255    04519 Cadherin signaling     101769255  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101769255    04148 Efferocytosis     101769255  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101769255  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101769255  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sita04131]     101769255   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sita04147]     101769255    04031 GTP-binding proteins [BR:sita04031]     101769255 Membrane trafficking [BR:sita04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101769255  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101769255   Macropinocytosis    Ras GTPases     101769255  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101769255 Exosome [BR:sita04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101769255   Exosomal proteins of other body fluids (saliva and urine)    101769255   Exosomal proteins of colorectal cancer cells    101769255   Exosomal proteins of bladder cancer cells    101769255 GTP-binding proteins [BR:sita04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101769255 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  101769255 NCBI-ProteinID:  XP_022683865 LinkDB All DBs Position I:42053707..42056303 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFADHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVLQP PKQKRRRRKAQKGCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcatcaagtgcgtcaccgtgggggacggcgccgtcggcaagacc tgcatgctcatctcctacacctccaacactttccccaccgattatgttccaactgtgttc gacaacttcagtgccaacgttgtggtcgatgggagcactgtcaacttgggtctgtgggat acggcaggacaggaggactacaacagactgcgcccgttgagctaccgtggtgctgatgtt tttctgctcgccttttctcttatcagcaaagcaagctacgagaatgtatcaaagaagtgg attcctgaattaaggcactatgctcctggcgtgcccataattcttgtcgggaccaagctt gatctgcgggatgataagcagttttttgctgatcaccctggtgctgttccgatttccacg gcccagggtgaagagctgaggaagctaattggagcggctgcctacatcgaatgcagttca aaaacccaacaaaacatcaaagcagtgtttgacgcggccattaaggtggttctccagcct ccaaagcaaaagaggaggaggaggaaggcgcagaaaggatgcaccattttgtaa

DBGET integrated database retrieval system