Setaria italica (foxtail millet): 101769255 Help Entry 101769255         CDS       T02818                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sita  Setaria italica (foxtail millet) Pathway sita04145   Phagosome sita04148   Efferocytosis sita04620   Toll-like receptor signaling pathway sita05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sita00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101769255    04148 Efferocytosis     101769255  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101769255  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101769255  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sita04131]     101769255   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sita04147]     101769255    04031 GTP-binding proteins [BR:sita04031]     101769255 Membrane trafficking [BR:sita04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101769255  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101769255   Macropinocytosis    Ras GTPases     101769255  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101769255 Exosome [BR:sita04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101769255   Exosomal proteins of other body fluids (saliva and urine)    101769255   Exosomal proteins of colorectal cancer cells    101769255   Exosomal proteins of bladder cancer cells    101769255 GTP-binding proteins [BR:sita04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101769255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  101769255 NCBI-ProteinID:  XP_022683865 LinkDB All DBs Position I:42053707..42056303 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFADHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVLQP PKQKRRRRKAQKGCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcatcaagtgcgtcaccgtgggggacggcgccgtcggcaagacc tgcatgctcatctcctacacctccaacactttccccaccgattatgttccaactgtgttc gacaacttcagtgccaacgttgtggtcgatgggagcactgtcaacttgggtctgtgggat acggcaggacaggaggactacaacagactgcgcccgttgagctaccgtggtgctgatgtt tttctgctcgccttttctcttatcagcaaagcaagctacgagaatgtatcaaagaagtgg attcctgaattaaggcactatgctcctggcgtgcccataattcttgtcgggaccaagctt gatctgcgggatgataagcagttttttgctgatcaccctggtgctgttccgatttccacg gcccagggtgaagagctgaggaagctaattggagcggctgcctacatcgaatgcagttca aaaacccaacaaaacatcaaagcagtgtttgacgcggccattaaggtggttctccagcct ccaaagcaaaagaggaggaggaggaaggcgcagaaaggatgcaccattttgtaa

DBGET integrated database retrieval system