Setaria italica (foxtail millet): 101781634 Help Entry 101781634         CDS       T02818                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sita  Setaria italica (foxtail millet) Pathway sita04145   Phagosome sita04148   Efferocytosis sita04620   Toll-like receptor signaling pathway sita05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sita00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101781634    04148 Efferocytosis     101781634  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101781634  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101781634  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sita04131]     101781634   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sita04147]     101781634    04031 GTP-binding proteins [BR:sita04031]     101781634 Membrane trafficking [BR:sita04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101781634  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101781634   Macropinocytosis    Ras GTPases     101781634  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101781634 Exosome [BR:sita04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101781634   Exosomal proteins of other body fluids (saliva and urine)    101781634   Exosomal proteins of colorectal cancer cells    101781634   Exosomal proteins of bladder cancer cells    101781634 GTP-binding proteins [BR:sita04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101781634 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  101781634 NCBI-ProteinID:  XP_004952335 UniProt:  K3YVV3 LinkDB All DBs Position I:complement(14611769..14614187) Genome browser AA seq 197 aa AA seqDB search MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL DLREDKQFFLDHPGLAPITTAQGEELKRMIGAAAYIECSSKTQQNVKAVFDSAIKVVLCP PKPKKKSARKQRSCWIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcacggcgaggttcatcaagtgcgtcacggtcggcgacggcgccgtcggcaagacc tgcatgctcatctcctacaccagcaacaccttccccacggattatgtgcccacggtgttc gacaacttcagcgccaacgtcgtcgtcgacggcaacacggtgaacctcggcctctgggat accgccggacaagaggactacaacaggcttaggcctcttagctacagaggggctgatgtc tttctgctagcattttccctcatcagcaaagcgagctatgagaatattcacaagaagtgg ataccagagctaaggcattatgctccaaatgtgccgattgtgttagttggaacaaaactt gacttgcgtgaggacaagcagttcttcctggaccaccctggtttagcccctatcactact gcacagggcgaggagctgaaaaggatgataggcgcagctgcatacatcgaatgcagctcc aagacgcaacagaatgtgaaggcggtgttcgactccgcgataaaggtcgtgctgtgcccg cccaagccaaagaagaagagcgcccggaagcagaggagttgctggatcctatga

DBGET integrated database retrieval system