Setaria italica (foxtail millet): 101781643 Help Entry 101781643         CDS       T02818                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism sita  Setaria italica (foxtail millet) Pathway sita03030   DNA replication sita03410   Base excision repair sita03420   Nucleotide excision repair sita03430   Mismatch repair sita03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sita00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101781643    03410 Base excision repair     101781643    03420 Nucleotide excision repair     101781643    03430 Mismatch repair     101781643    03440 Homologous recombination     101781643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sita03032]     101781643    03400 DNA repair and recombination proteins [BR:sita03400]     101781643 DNA replication proteins [BR:sita03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101781643 DNA repair and recombination proteins [BR:sita03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101781643    MMR (mismatch excision repair)     DNA polymerase delta complex      101781643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Nha1_C Motif Other DBs NCBI-GeneID:  101781643 NCBI-ProteinID:  XP_004972756 UniProt:  A0A368RI52 LinkDB All DBs Position VI:3921644..3922575 Genome browser AA seq 121 aa AA seqDB search MTRGGDMKSFFRQQKAHAATKPTGGVSKKTAAAAAAHHHQKAAPALHVNAATDHGRQQEE AEAEERERAARSFDMDMRYGPCLGLTRAQRLRRAAALGLAPPPALLALCTDDQPCLWEGR V NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgacgaggggcggcgacatgaagtccttcttccggcagcagaaggcgcacgccgccacc aagccaaccggcggcgtctccaagaagacggcggcggcggcggcggctcaccaccaccag aaggccgcgcccgccctccacgtcaacgccgccacagatcacgggcgccagcaggaggag gcggaggcggaggagcgggagcgggcggcccggtcgttcgacatggacatgcggtacgga ccctgcctcggcctcacccgcgcccagcgcctgcgccgcgccgccgcgctcgggctcgcc ccgccgccggcgctcctcgctctctgcacggacgaccagccctgcctctgggagggacgc gtctag

DBGET integrated database retrieval system