Setaria italica (foxtail millet): 101783758 Help Entry 101783758         CDS       T02818                                  Name (RefSeq) ADP-ribosylation factor 1-like   KO K07937   ADP-ribosylation factor 1/2 Organism sita  Setaria italica (foxtail millet) Pathway sita04144   Endocytosis Brite KEGG Orthology (KO) [BR:sita00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101783758  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sita04131]     101783758   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sita04147]     101783758    04031 GTP-binding proteins [BR:sita04031]     101783758 Membrane trafficking [BR:sita04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     101783758   Arf GTPases and associated proteins    Arf GTPases     101783758  Endosome - Golgi transport     101783758 Exosome [BR:sita04147]  Exosomal proteins   Proteins found in most exosomes    101783758 GTP-binding proteins [BR:sita04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101783758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Gtr1_RagA CAPN13-like_C_EFh RXYLT1_N FLAD1_M G-alpha Motif Other DBs NCBI-GeneID:  101783758 NCBI-ProteinID:  XP_022681629 LinkDB All DBs Position IV:complement(3683451..3686173) Genome browser AA seq 105 aa AA seqDB search MTLRMSCGRRRREGCTRYEMESPIEIMPLWRHYFQNTQGLVFVVDSNDRDRVVEARDELH RMLNEDELRDAVLLVFANKQDLPNAMNAAEIIDKLGLHSLRQHHW NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgacgctccgcatgagctgtgggcggaggaggcgggagggctgcacaagatatgagatg gaaagcccaatagagatcatgccgctgtggaggcattacttccagaacacacagggtctc gtcttcgttgtggatagcaacgatagggatcgtgttgttgaagccagggatgagctccac cgaatgctgaatgaggatgaattacgtgatgctgtgttgcttgtgtttgctaacaagcaa gatcttccgaatgctatgaacgctgctgagattattgataagcttggacttcactcactt cgccagcatcactggtaa

DBGET integrated database retrieval system