KEGG   Stappia indica: GH266_04520
Entry
GH266_04520       CDS       T06350                                 
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
siw  Stappia indica
Pathway
siw03030  DNA replication
siw03430  Mismatch repair
siw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:siw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GH266_04520
   03430 Mismatch repair
    GH266_04520
   03440 Homologous recombination
    GH266_04520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:siw03032]
    GH266_04520
   03400 DNA repair and recombination proteins [BR:siw03400]
    GH266_04520
   03029 Mitochondrial biogenesis [BR:siw03029]
    GH266_04520
DNA replication proteins [BR:siw03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    GH266_04520
DNA repair and recombination proteins [BR:siw03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     GH266_04520
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    GH266_04520
Mitochondrial biogenesis [BR:siw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    GH266_04520
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: QGZ33837
UniProt: A0A857C4H8
LinkDB
Position
complement(971625..972209)
AA seq 194 aa
MSGSVNKVILVGNLGADPEVRRMQDGRPVVNLRIATSETWRDRSSGERKERTEWHRVVIF
NEGLAKVAENYLRKGSKVYIEGQLQTRKWQDQSGQERYSTEVVLQGFNSTLTMLDGRGEG
GGGGGGGGRSVEGGGSGGGYEGGSGGGYGGGSGGGYGGGSGGGYGGGSGGSGGGSGGSGG
GFGGGSDMDDEIPF
NT seq 585 nt   +upstreamnt  +downstreamnt
atgtcgggaagcgtcaacaaggtgatcctggtgggcaatctgggagccgatccggaggtc
cgccggatgcaggacgggcgcccggtggtcaacttgcgcatcgccacctcggagacctgg
cgggaccgcagctcgggcgagcgcaaggagcgcaccgagtggcaccgcgtggtgatcttc
aacgaaggcctggccaaggtcgccgaaaactatctgcgcaagggctccaaggtctatatc
gagggccagctgcagacccgcaagtggcaggaccagtccggccaggagcgctattccacg
gaagtcgtgctgcagggcttcaactcgacgctgaccatgctcgacggtcgcggcgagggc
ggcggtggcggtggcggcggcggccgctctgtcgaaggcggcggttctggcggcggctat
gagggcggctccggcggcggctacggtggcggttcgggcggcggctatggcggcggttcg
ggcggtgggtatggcggcggctcgggcggctccggcggcgggtccggtggttctggcggc
ggcttcggcggcggctcggacatggacgacgagatcccgttctga

DBGET integrated database retrieval system