Stappia indica: GH266_07035 Help Entry GH266_07035       CDS       T06350                                  Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism siw  Stappia indica Pathway siw00362   Benzoate degradation siw00621   Dioxin degradation siw00622   Xylene degradation siw01100   Metabolic pathways siw01120   Microbial metabolism in diverse environments siw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:siw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     GH266_07035    00622 Xylene degradation     GH266_07035    00621 Dioxin degradation     GH266_07035 Enzymes [BR:siw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      GH266_07035 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 HTH_26 Motif Other DBs NCBI-ProteinID:  QGZ34283 UniProt:  A0A857C5Q9 LinkDB All DBs Position 1488150..1488356 Genome browser AA seq 68 aa AA seqDB search MPIVDMKMLEGFSQDQKEAMYAEVTDALCRTLGCRPDQVRIMVSDLATGDFAIAGKSVAA MRKAPPSS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccgattgtcgacatgaagatgctggaagggttttcgcaggatcagaaggaggcgatg tacgcggaagtcacggacgcgctctgccgcaccctgggctgccggccggaccaggtccgc atcatggtgagcgaccttgccaccggcgacttcgcgattgccggcaagagcgttgccgcg atgcgtaaggcgccgccttcctcctga

DBGET integrated database retrieval system