Stappia indica: GH266_11495 Help Entry GH266_11495       CDS       T06350                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism siw  Stappia indica Pathway siw00998   Biosynthesis of various antibiotics siw01100   Metabolic pathways siw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:siw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GH266_11495    00074 Mycolic acid biosynthesis     GH266_11495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GH266_11495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QGZ35074 UniProt:  A0A857C7W4 LinkDB All DBs Position complement(2461706..2461957) Genome browser AA seq 83 aa AA seqDB search MTDASESQLFSFLREQVAQRTKTSADQIRMDMSLSDLGLQSIDAVLVCGEVEDRFEVEVD PAEIFQHDTLGDFARSIADRMAA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgacgccagcgaatcccagctgttctccttccttcgcgaacaggttgcccagcgg accaagacctcggccgaccagatccgcatggacatgtccctgtcggatctcggcctgcag tcgatcgacgcggttctcgtctgcggcgaggtcgaggaccgcttcgaggtggaggtcgat cctgcggagatctttcagcacgacacgctcggcgacttcgcacggtcgatagcggatcgc atggcagcctga

DBGET integrated database retrieval system